Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD).)

Mouse anti-Human ACSL5 Monoclonal Antibody | anti-ACSL5 antibody

ACSL5 (Long-chain-fatty-acid-CoA Ligase 5, Long-chain acyl-CoA Synthetase 5, LACS 5, ACS5, FACL5, UNQ633/PRO1250) (PE)

Gene Names
ACSL5; ACS2; ACS5; FACL5
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACSL5; Monoclonal Antibody; ACSL5 (Long-chain-fatty-acid-CoA Ligase 5; Long-chain acyl-CoA Synthetase 5; LACS 5; ACS5; FACL5; UNQ633/PRO1250) (PE); anti-ACSL5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5H8
Specificity
Recognizes human ACSL5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
739
Applicable Applications for anti-ACSL5 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa91-187, from human ACSL5 (NP_057318, 51703) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.67kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD).)

Western Blot (WB)

(Western Blot analysis of ACSL5 expression in transfected 293T cell line by ACSL5 monoclonal antibody. Lane 1: ACSL5 transfected lysate (82.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ACSL5 expression in transfected 293T cell line by ACSL5 monoclonal antibody. Lane 1: ACSL5 transfected lysate (82.3kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ACSL5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ACSL5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of ACSL5 transfected lysate using ACSL5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACSL5 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of ACSL5 transfected lysate using ACSL5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACSL5 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged ACSL5 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ACSL5 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(ACSL5 monoclonal antibody, Western Blot analysis of ACSL5 expression in HepG2.)

Western Blot (WB) (ACSL5 monoclonal antibody, Western Blot analysis of ACSL5 expression in HepG2.)
Product Categories/Family for anti-ACSL5 antibody
References
1. Tripodi D, Quemener S, Renaudin K, Ferron C, Malard O, Guisle-Marsollier I, Sebille-Rivain V, Verger C, Geraut C, Gratas-Rabbia-Re C.BMC Med Genomics. 2009 Nov 10;2:652. 2. Mashima T, Sato S, Sugimoto Y, Tsuruo T, Seimiya H.Oncogene. 2009 Jan 8;28(1):9-19. Epub 2008 Sep 22.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
long-chain-fatty-acid--CoA ligase 5 isoform a
NCBI Official Synonym Full Names
acyl-CoA synthetase long chain family member 5
NCBI Official Symbol
ACSL5
NCBI Official Synonym Symbols
ACS2; ACS5; FACL5
NCBI Protein Information
long-chain-fatty-acid--CoA ligase 5
UniProt Protein Name
Long-chain-fatty-acid--CoA ligase 5
UniProt Gene Name
ACSL5
UniProt Synonym Gene Names
ACS5; FACL5; LACS 5
UniProt Entry Name
ACSL5_HUMAN

NCBI Description

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ACSL5: Acyl-CoA synthetases (ACSL) activate long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL5 may activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage. Utilizes a wide range of saturated fatty acids with a preference for C16-C18 unsaturated fatty acids. It was suggested that it may also stimulate fatty acid oxidation. At the villus tip of the crypt-villus axis of the small intestine may sensitize epithelial cells to apoptosis specifically triggered by the death ligand TRAIL. May have a role in the survival of glioma cells. Belongs to the ATP-dependent AMP-binding enzyme family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - fatty acid; Membrane protein, integral; Ligase; Mitochondrial; EC 6.2.1.3

Chromosomal Location of Human Ortholog: 10q25.2

Cellular Component: endoplasmic reticulum membrane; mitochondrial outer membrane; mitochondrion; membrane; endoplasmic reticulum; mitochondrial inner membrane; nucleolus; integral to membrane; nucleus

Molecular Function: ATP binding; long-chain-fatty-acid-CoA ligase activity

Biological Process: triacylglycerol biosynthetic process; cellular lipid metabolic process; long-chain fatty acid metabolic process

Research Articles on ACSL5

Similar Products

Product Notes

The ACSL5 acsl5 (Catalog #AAA6156364) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACSL5 (Long-chain-fatty-acid-CoA Ligase 5, Long-chain acyl-CoA Synthetase 5, LACS 5, ACS5, FACL5, UNQ633/PRO1250) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACSL5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACSL5 acsl5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACSL5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.