Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human ACSL1 Monoclonal Antibody | anti-ACSL1 antibody

ACSL1 (Acyl-CoA Synthetase Long-chain Family Member 1, Acyl-CoA Synthetase 1, ACS1, FACL1, FACL2, LACS, Long-chain-fatty-acid-CoA Ligase 1, Long-chain Fatty Acid-CoA Ligase 2, Long-chain Acyl-CoA Synthetase 1, LACS 1, LACS1, Long-chain Acyl-CoA Synthetase

Gene Names
ACSL1; ACS1; LACS; FACL1; FACL2; LACS1; LACS2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACSL1; Monoclonal Antibody; ACSL1 (Acyl-CoA Synthetase Long-chain Family Member 1; Acyl-CoA Synthetase 1; ACS1; FACL1; FACL2; LACS; Long-chain-fatty-acid-CoA Ligase 1; Long-chain Fatty Acid-CoA Ligase 2; Long-chain Acyl-CoA Synthetase 1; LACS 1; LACS1; Long-chain Acyl-CoA Synthetase; anti-ACSL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G4
Specificity
Recognizes human ACSL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ACSL1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa48-145 from human ACSL1 (NP_001986) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Testing Data

(Detection limit for recombinant GST tagged ACSL1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ACSL1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-ACSL1 antibody
Mammalian long-chain acyl-CoA synthetase (ACSL) catalyzes the ligation of the fatty acid to CoA to form fatty acyl-CoA in a two-step reaction. Five isoforms of ACSL have been identified. These isoforms have different substrate preferences and subcellular localizations. Overexpression of ACSL1 results in changes of fatty acid metabolism in rat primary hepatocytes.
Product Categories/Family for anti-ACSL1 antibody
References
1. Fatty acid transport and activation and the expression patterns of genes involved in fatty acid trafficking. Sandoval A, Fraisl P, Arias-Barrau E, DiRusso CD, Singer D, Sealls W, Black PN.Arch Biochem Biophys. 2008 Sep 15;477(2):363-71. Epub 2008 Jun 20.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77 kDa
NCBI Official Full Name
long-chain-fatty-acid--CoA ligase 1 isoform a
NCBI Official Synonym Full Names
acyl-CoA synthetase long-chain family member 1
NCBI Official Symbol
ACSL1
NCBI Official Synonym Symbols
ACS1; LACS; FACL1; FACL2; LACS1; LACS2
NCBI Protein Information
long-chain-fatty-acid--CoA ligase 1; LACS 1; LACS 2; acyl-CoA synthetase 1; palmitoyl-CoA ligase 1; palmitoyl-CoA ligase 2; paltimoyl-CoA ligase 1; lignoceroyl-CoA synthase; long-chain acyl-CoA synthetase 1; long-chain acyl-CoA synthetase 2; long-chain fa
UniProt Protein Name
Long-chain-fatty-acid--CoA ligase 1
UniProt Gene Name
ACSL1
UniProt Synonym Gene Names
FACL1; FACL2; LACS; LACS1; LACS2; ACS1; LACS 1; LACS 2
UniProt Entry Name
ACSL1_HUMAN

NCBI Description

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]

Uniprot Description

ACSL1: Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses palmitoleate, oleate and linoleate. Highly expressed in liver, heart, skeletal muscle, kidney and erythroid cells, and to a lesser extent in brain, lung, placenta and pancreas. Belongs to the ATP-dependent AMP-binding enzyme family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - fatty acid; Ligase; Membrane protein, integral; EC 6.2.1.3

Chromosomal Location of Human Ortholog: 4q35.1

Cellular Component: peroxisomal membrane; mitochondrial outer membrane; endoplasmic reticulum membrane; mitochondrion; membrane; plasma membrane; integral to membrane

Molecular Function: ATP binding; long-chain-fatty-acid-CoA ligase activity

Biological Process: response to drug; response to oleate; unsaturated fatty acid metabolic process; lipid biosynthetic process; linoleic acid metabolic process; adiponectin-mediated signaling pathway; triacylglycerol biosynthetic process; cellular lipid metabolic process; long-chain fatty acid metabolic process; response to organic cyclic substance; response to nutrient; xenobiotic catabolic process

Research Articles on ACSL1

Similar Products

Product Notes

The ACSL1 acsl1 (Catalog #AAA6135151) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACSL1 (Acyl-CoA Synthetase Long-chain Family Member 1, Acyl-CoA Synthetase 1, ACS1, FACL1, FACL2, LACS, Long-chain-fatty-acid-CoA Ligase 1, Long-chain Fatty Acid-CoA Ligase 2, Long-chain Acyl-CoA Synthetase 1, LACS 1, LACS1, Long-chain Acyl-CoA Synthetase reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACSL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACSL1 acsl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACSL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.