Mouse anti-Human ACO1 Monoclonal Antibody | anti-ACO1 antibody

ACO1 (Cytoplasmic Aconitate Hydratase, Aconitase, Citrate Hydro-lyase, Ferritin Repressor Protein, Iron Regulatory Protein 1, IRP1, Iron-responsive Element-binding Protein 1, IRE-BP 1, IREB1) (HRP)

Cat. Num. AAA6151050

• Gene Names: ACO1; IRP1; ACONS; HEL60; IREB1; IREBP; IREBP1
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ACO1; Monoclonal Antibody; ACO1 (Cytoplasmic Aconitate Hydratase; Aconitase; Citrate Hydro-lyase; Ferritin Repressor Protein; Iron Regulatory Protein 1; IRP1; Iron-responsive Element-binding Protein 1; IRE-BP 1; IREB1) (HRP); anti-ACO1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2C1
• Specificity: Recognizes human ACO1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 3443

• Applicable Applications for anti-ACO1 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa780-889 from human ACO1 (AAH18103) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of ACO1 transfected lysate using ACO1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ACO1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged ACO1 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-ACO1 antibody

Aconitase (aconitate hydratase; EC 4.2.1.3) is an iron-sulfur protein containing an [Fe4S4]2+ cluster that catalyzes the stereospecific isomerization of citrate to isocitrate via cis-aconitate in the tricarboxylic acid cycle, a non-redox-active process. Tissue contains two aconitases, a mitochondrial (m-) and a cytosolic (c-) aconitase. They are related, but distinctly different enzymes and are coded for on different chromosomes. Loss of aconitase activity in cells or other biological samples treated with pro-oxidants has been interpreted as a measure of oxidative damage.

Product Categories/Family for anti-ACO1 antibody

Antibodies; Enzymes

References

1. IF/TA-related metabolic changes?Xproteome analysis of rat renal allografts. Reuter S, Reiermann S, Worner R, Schroter R, Edemir B, Buck F, Henning S, Peter-Katalinic J, Vollenbroker B, Amann K, Pavenstadt H, Schlatter E, Gabriels G.Nephrol Dial Transplant. 2010 Feb 22.

NCBI and Uniprot Product Information

• NCBI GI #: 17390224
• NCBI GeneID: 48
• NCBI Official Full Name: Homo sapiens aconitase 1, soluble, mRNA
• NCBI Official Synonym Full Names: aconitase 1
• NCBI Official Symbol: ACO1
• NCBI Official Synonym Symbols: IRP1; ACONS; HEL60; IREB1; IREBP; IREBP1
• NCBI Protein Information: cytoplasmic aconitate hydratase
• Protein Family: Aconitate hydratase

NCBI Description

The protein encoded by this gene is a bifunctional, cytosolic protein that functions as an essential enzyme in the TCA cycle and interacts with mRNA to control the levels of iron inside cells. When cellular iron levels are high, this protein binds to a 4Fe-4S cluster and functions as an aconitase. Aconitases are iron-sulfur proteins that function to catalyze the conversion of citrate to isocitrate. When cellular iron levels are low, the protein binds to iron-responsive elements (IREs), which are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. When the protein binds to IRE, it results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degraded transferrin receptor mRNA. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alternative splicing results in multiple transcript variants [provided by RefSeq, Jan 2014]