Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse ACHE Monoclonal Antibody | anti-ACHE antibody

ACHE (Acetylcholinesterase (Yt Blood Group), ARACHE, N-ACHE, YT) (AP)

Gene Names
ACHE; YT; ACEE; ARACHE; N-ACHE
Applications
ELISA
Purity
Purified
Synonyms
ACHE; Monoclonal Antibody; ACHE (Acetylcholinesterase (Yt Blood Group); ARACHE; N-ACHE; YT) (AP); Acetylcholinesterase (Yt Blood Group); YT; anti-ACHE antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C3
Specificity
Recognizes ACHE.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ACHE antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ACHE (NP_000656, 515aa-614aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ACHE antibody
Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood group antigen. Acetylcholinesterase exists in multiple molecular forms which possess similar catalytic properties, but differ in their oligomeric assembly and mode of cell attachment to the cell surface. It is encoded by the single ACHE gene, and the structural diversity in the gene products arises from alternative mRNA splicing, and post-translational associations of catalytic and structural subunits. The major form of acetylcholinesterase found in brain, muscle and other tissues is the hydrophilic species, which forms disulfide-linked oligomers with collagenous, or lipid-containing structural subunits. The other, alternatively spliced form, expressed primarily in the erythroid tissues, differs at the C-terminal end, and contains a cleavable hydrophobic peptide with a GPI-anchor site. It associates with the membranes through the phosphoinositide (PI) moieties added post-translationally. [provided by RefSeq]
Product Categories/Family for anti-ACHE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
43
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
58,352 Da
NCBI Official Full Name
acetylcholinesterase isoform E4-E6
NCBI Official Synonym Full Names
acetylcholinesterase (Yt blood group)
NCBI Official Symbol
ACHE
NCBI Official Synonym Symbols
YT; ACEE; ARACHE; N-ACHE
NCBI Protein Information
acetylcholinesterase; Yt blood group; apoptosis-related acetylcholinesterase
UniProt Protein Name
Acetylcholinesterase
Protein Family
UniProt Gene Name
ACHE
UniProt Synonym Gene Names
AChE
UniProt Entry Name
ACES_HUMAN

Uniprot Description

ACHE: Terminates signal transduction at the neuromuscular junction by rapid hydrolysis of the acetylcholine released into the synaptic cleft. Role in neuronal apoptosis. Belongs to the type-B carboxylesterase/lipase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Membrane protein, GPI anchor; Lipid Metabolism - glycerophospholipid; EC 3.1.1.7

Chromosomal Location of Human Ortholog: 7q22

Cellular Component: Golgi apparatus; extracellular space; cell surface; membrane; perinuclear region of cytoplasm; extracellular region; plasma membrane; synapse; basal lamina; neuromuscular junction; nucleus; cell junction

Molecular Function: collagen binding; serine hydrolase activity; protein binding; protein homodimerization activity; protein self-association; cholinesterase activity; hydrolase activity; beta-amyloid binding; laminin binding; acetylcholinesterase activity; acetylcholine binding

Biological Process: negative regulation of synaptic transmission, cholinergic; nervous system development; muscle development; acetylcholine catabolic process in synaptic cleft; acetylcholine catabolic process; glycerophospholipid biosynthetic process; osteoblast development; synaptic transmission; cell proliferation; synaptogenesis; positive regulation of protein secretion; amyloid precursor protein metabolic process; retina development in camera-type eye; phospholipid metabolic process; neurotransmitter receptor biosynthetic process; receptor internalization; response to wounding; phosphatidylcholine biosynthetic process; regulation of receptor recycling; DNA replication; cell adhesion; protein tetramerization; neurotransmitter biosynthetic process

Disease: Yt Blood Group Antigen

Similar Products

Product Notes

The ACHE ache (Catalog #AAA6163055) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ACHE can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACHE ache for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACHE, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.