Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ACE Monoclonal Antibody | anti-ACE antibody

ACE (Angiotensin-converting Enzyme, Dipeptidyl Carboxypeptidase I, Kininase II, CD143, Angiotensin-converting Enzyme, Soluble Form, DCP, DCP1) (MaxLight 750)

Gene Names
ACE; DCP; ACE1; DCP1; CD143
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACE; Monoclonal Antibody; ACE (Angiotensin-converting Enzyme; Dipeptidyl Carboxypeptidase I; Kininase II; CD143; Angiotensin-converting Enzyme; Soluble Form; DCP; DCP1) (MaxLight 750); anti-ACE antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6A4
Specificity
Recognizes human ACE.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
4874
Applicable Applications for anti-ACE antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa592-701 from human ACE (AAH36375) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQARGTREAPVYM
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ACE antibody
ACE is an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Two most abundant alternatively spliced variants of this gene encode two isozymes-the somatic form and the testicular form that are equally active.
Product Categories/Family for anti-ACE antibody
References
1. The dual organization of P-bodies revealed by immunoelectron microscopy and electron tomography. Cougot N, Cavalier A, Thomas D, Gillet R.J Mol Biol. 2012 Apr 3. 2. Drosophila genome-wide RNAi screen identifies multiple regulators of HIF-dependent transcription in hypoxia. Dekanty A, Romero NM, Bertolin AP, Thomas MG, Leishman CC, Perez-Perri JI, Boccaccio GL, Wappner P.PLoS Genet. 2010 Jun 24;6(6):e1000994.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens angiotensin I converting enzyme (peptidyl-dipeptidase A) 1, mRNA
NCBI Official Synonym Full Names
angiotensin I converting enzyme
NCBI Official Symbol
ACE
NCBI Official Synonym Symbols
DCP; ACE1; DCP1; CD143
NCBI Protein Information
angiotensin-converting enzyme
Protein Family

NCBI Description

This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Multiple alternatively spliced transcript variants encoding different isoforms have been identified, and two most abundant spliced variants encode the somatic form and the testicular form, respectively, that are equally active. [provided by RefSeq, May 2010]

Research Articles on ACE

Similar Products

Product Notes

The ACE (Catalog #AAA6231398) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACE (Angiotensin-converting Enzyme, Dipeptidyl Carboxypeptidase I, Kininase II, CD143, Angiotensin-converting Enzyme, Soluble Form, DCP, DCP1) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACE can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACE for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACE, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.