Mouse ACBD3 Monoclonal Antibody | anti-ACBD3 antibody

ACBD3 (Golgi Resident Protein GCP60, Acyl-CoA-binding Domain-containing Protein 3, Golgi Complex-associated Protein 1, GOCAP1, Golgi Phosphoprotein 1, GOLPH1, PBR- and PKA-associated Protein 7, Peripheral Benzodiazepine Receptor-associated Protein PAP7, G

Cat. Num. AAA6145742

• Gene Names: ACBD3; PAP7; GCP60; GOCAP1; GOLPH1
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ACBD3; Monoclonal Antibody; ACBD3 (Golgi Resident Protein GCP60; Acyl-CoA-binding Domain-containing Protein 3; Golgi Complex-associated Protein 1; GOCAP1; Golgi Phosphoprotein 1; GOLPH1; PBR- and PKA-associated Protein 7; Peripheral Benzodiazepine Receptor-associated Protein PAP7; G; anti-ACBD3 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2G2
• Specificity: Recognizes human ACBD3. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ACBD3 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa73-172 from human ACBD3 (NP_073572) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of ACBD3 expression in transfected 293T cell line by ACBD3 monoclonal antibody. Lane 1: ACBD3 transfected lysate (60.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ACBD3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ACBD3 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(ACBD3 monoclonal antibody, Western Blot analysis of ACBD3 expression in HeLa.)

Western Blot (WB)

(ACBD3 monoclonal antibody. Western Blot analysis of ACBD3 expression in PC-12.)

Product Categories/Family for anti-ACBD3 antibody

Antibodies; Golgi Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15826852
• NCBI GeneID: 64746
• NCBI Accession #: NP_073572
• NCBI GenBank Nucleotide #: NM_022735
• UniProt Accession #: Q9H3P7
• Molecular Weight: 60kDa
• NCBI Official Full Name: Golgi resident protein GCP60
• NCBI Official Synonym Full Names: acyl-CoA binding domain containing 3
• NCBI Official Symbol: ACBD3
• NCBI Official Synonym Symbols: PAP7; GCP60; GOCAP1; GOLPH1
• NCBI Protein Information: Golgi resident protein GCP60
• UniProt Protein Name: Golgi resident protein GCP60
• Protein Family: Golgi resident protein
• UniProt Gene Name: ACBD3
• UniProt Synonym Gene Names: GCP60; GOCAP1; GOLPH1; GOCAP1; GOLPH1
• UniProt Entry Name: GCP60_HUMAN

NCBI Description

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq, Jul 2008]

Uniprot Description

ACBD3: Involved in the maintenance of Golgi structure by interacting with giantin, affecting protein transport between the endoplasmic reticulum and Golgi. Involved in hormone-induced steroid biosynthesis in testicular Leydig cells.

Chromosomal Location of Human Ortholog: 1q42.12

Cellular Component: Golgi membrane; Golgi apparatus; mitochondrion; membrane; integral to membrane

Molecular Function: protein binding; acyl-CoA binding

Biological Process: transport; steroid biosynthetic process