Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD))

Mouse anti-Human ACACA Monoclonal Antibody | anti-ACACA antibody

ACACA (Acetyl-CoA Carboxylase 1, ACC1, ACC-alpha, ACAC, ACC1, ACCA) (PE)

Gene Names
ACACA; ACC; ACAC; ACC1; ACCA; ACACAD
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACACA; Monoclonal Antibody; ACACA (Acetyl-CoA Carboxylase 1; ACC1; ACC-alpha; ACAC; ACCA) (PE); anti-ACACA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6H5
Specificity
Recognizes human ACACA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
2383
Applicable Applications for anti-ACACA antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-99 from human ACACA (NP_942131) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIMDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD))

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD))

Testing Data

(Detection limit for recombinant GST tagged ACACA is ~0.03ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged ACACA is ~0.03ng/ml as a capture antibody)
Related Product Information for anti-ACACA antibody
ACACA (Acetyl-CoA carboxylase alpha/1 also ACC1and biotin carboxylase) is a 260-265kD cytoplasmic, phosphorylated biotinylenzyme.It is widely expressed, and found to be concentrated in hepatocytes, adipocytes and lactating mammary epithelium. It is one of two gene products (ACACB/beta being the other) that catalyze the formation of malonylCoA from acetylCoA. The formation of malonylCoA by ACACA is a rate limiting step in fatty acid synthesis malonylCoA formed by ACACB acts as a regulator of CPT1 during fatty aciid oxidation. Human ACACA is 2346aa in length. It contains an N-terminal acetylated Met, one ATPGrasp-domain (aa275-466) with an embedded biotin carboxylation domain (aa117-618), a biotinyl binding region (aa752-818), and a carboxyl transferase domain (aa1698-2194). There are at least 17 utilized phosphorylation sites, and two acetylated Lys. ACACA exists as either a dimer or higher order oligomer. Multiple splice variants exist. One possesses an alternative start site at Met79, a second utilizes an alternative start site 37aa upstream of the standard site, and a third (called PIII) shows a 17aa substitution for aa1-75. Over aa1185-1352, human ACACA shares 95% aa identity with mouse ACACA, and 97% aa identity with both ovine and bovine ACAC-A.
Product Categories/Family for anti-ACACA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
31
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
acetyl-CoA carboxylase 1 isoform 1
NCBI Official Synonym Full Names
acetyl-CoA carboxylase alpha
NCBI Official Symbol
ACACA
NCBI Official Synonym Symbols
ACC; ACAC; ACC1; ACCA; ACACAD
NCBI Protein Information
acetyl-CoA carboxylase 1
UniProt Protein Name
Acetyl-CoA carboxylase 1
UniProt Gene Name
ACACA
UniProt Synonym Gene Names
ACAC; ACC1; ACCA; ACC1
UniProt Entry Name
ACACA_HUMAN

NCBI Description

Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and beta, encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. The enzyme is under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Multiple alternatively spliced transcript variants divergent in the 5' sequence and encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ACC1: a subunit of acetyl-CoA carboxylase (ACC), a multifunctional enzyme system. Catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. Phosphorylation by AMPK or PKA inhibits the enzymatic activity of ACC. ACC-alpha is the predominant isoform in liver, adipocyte and mammary gland. ACC-beta is the major isoform in skeletal muscle and heart. Phosphorylation regulates its activity.

Protein type: Ligase; EC 6.3.4.14; EC 6.4.1.2; Carbohydrate Metabolism - propanoate; Carbohydrate Metabolism - pyruvate; Lipid Metabolism - fatty acid biosynthesis

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: mitochondrion; cytoplasm; nucleolus; cytosol; actin cytoskeleton

Molecular Function: protein binding; acetyl-CoA carboxylase activity; metal ion binding; biotin carboxylase activity; ATP binding

Biological Process: vitamin metabolic process; acetyl-CoA metabolic process; multicellular organismal protein metabolic process; tissue homeostasis; positive regulation of cellular metabolic process; energy reserve metabolic process; lipid homeostasis; triacylglycerol biosynthetic process; carnitine shuttle; cellular lipid metabolic process; water-soluble vitamin metabolic process; fatty acid biosynthetic process; biotin metabolic process; protein homotetramerization

Disease: Acetyl-coa Carboxylase Deficiency

Research Articles on ACACA

Similar Products

Product Notes

The ACACA acaca (Catalog #AAA6156342) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACACA (Acetyl-CoA Carboxylase 1, ACC1, ACC-alpha, ACAC, ACC1, ACCA) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACACA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACACA acaca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACACA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.