Mouse anti-Human ACACA Monoclonal Antibody | anti-ACACA antibody

ACACA (Acetyl-CoA Carboxylase 1, ACC1, ACC-alpha, ACAC, ACC1, ACCA) (Biotin)

Cat. Num. AAA6140433

• Gene Names: ACACA; ACC; ACAC; ACC1; ACCA; ACACAD
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ACACA; Monoclonal Antibody; ACACA (Acetyl-CoA Carboxylase 1; ACC1; ACC-alpha; ACAC; ACCA) (Biotin); anti-ACACA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6H5
• Specificity: Recognizes human ACACA.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 2383

• Applicable Applications for anti-ACACA antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-99 from human ACACA (NP_942131) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MWWSTLMSILRARSFWKWISTQTVRIIRAVRAHFGGIMDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD))

Testing Data

(Detection limit for recombinant GST tagged ACACA is ~0.03ng/ml as a capture antibody)

Related Product Information for anti-ACACA antibody

ACACA (Acetyl-CoA carboxylase alpha/1 also ACC1and biotin carboxylase) is a 260-265kD cytoplasmic, phosphorylated biotinylenzyme.It is widely expressed, and found to be concentrated in hepatocytes, adipocytes and lactating mammary epithelium. It is one of two gene products (ACACB/beta being the other) that catalyze the formation of malonylCoA from acetylCoA. The formation of malonylCoA by ACACA is a rate limiting step in fatty acid synthesis malonylCoA formed by ACACB acts as a regulator of CPT1 during fatty aciid oxidation. Human ACACA is 2346aa in length. It contains an N-terminal acetylated Met, one ATPGrasp-domain (aa275-466) with an embedded biotin carboxylation domain (aa117-618), a biotinyl binding region (aa752-818), and a carboxyl transferase domain (aa1698-2194). There are at least 17 utilized phosphorylation sites, and two acetylated Lys. ACACA exists as either a dimer or higher order oligomer. Multiple splice variants exist. One possesses an alternative start site at Met79, a second utilizes an alternative start site 37aa upstream of the standard site, and a third (called PIII) shows a 17aa substitution for aa1-75. Over aa1185-1352, human ACACA shares 95% aa identity with mouse ACACA, and 97% aa identity with both ovine and bovine ACAC-A.

Product Categories/Family for anti-ACACA antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 38679960
• NCBI GeneID: 31
• NCBI Accession #: NP_942131
• NCBI GenBank Nucleotide #: NP_942131.1
• UniProt Accession #: Q13085
• NCBI Official Full Name: acetyl-CoA carboxylase 1 isoform 1
• NCBI Official Synonym Full Names: acetyl-CoA carboxylase alpha
• NCBI Official Symbol: ACACA
• NCBI Official Synonym Symbols: ACC; ACAC; ACC1; ACCA; ACACAD
• NCBI Protein Information: acetyl-CoA carboxylase 1
• UniProt Protein Name: Acetyl-CoA carboxylase 1
• UniProt Gene Name: ACACA
• UniProt Synonym Gene Names: ACAC; ACC1; ACCA; ACC1
• UniProt Entry Name: ACACA_HUMAN

NCBI Description

Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and beta, encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. The enzyme is under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Multiple alternatively spliced transcript variants divergent in the 5' sequence and encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ACC1: a subunit of acetyl-CoA carboxylase (ACC), a multifunctional enzyme system. Catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. Phosphorylation by AMPK or PKA inhibits the enzymatic activity of ACC. ACC-alpha is the predominant isoform in liver, adipocyte and mammary gland. ACC-beta is the major isoform in skeletal muscle and heart. Phosphorylation regulates its activity.

Protein type: Ligase; EC 6.3.4.14; EC 6.4.1.2; Carbohydrate Metabolism - propanoate; Carbohydrate Metabolism - pyruvate; Lipid Metabolism - fatty acid biosynthesis

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: mitochondrion; cytoplasm; nucleolus; cytosol; actin cytoskeleton

Molecular Function: protein binding; acetyl-CoA carboxylase activity; metal ion binding; biotin carboxylase activity; ATP binding

Biological Process: vitamin metabolic process; acetyl-CoA metabolic process; multicellular organismal protein metabolic process; tissue homeostasis; positive regulation of cellular metabolic process; energy reserve metabolic process; lipid homeostasis; triacylglycerol biosynthetic process; carnitine shuttle; cellular lipid metabolic process; water-soluble vitamin metabolic process; fatty acid biosynthetic process; biotin metabolic process; protein homotetramerization

Disease: Acetyl-coa Carboxylase Deficiency