Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ABO monoclonal antibody (M08), clone 1B7. Western Blot analysis of ABO expression in A-431.)

Mouse ABO Monoclonal Antibody | anti-ABO antibody

ABO (ABO Blood Group (Transferase A, alpha 1-3-N-acetylgalactosaminylTransferase; Transferase B, alpha 1-3-galactosylTransferase), A3GALNT, A3GALT1, GTB, NAGAT) (Biotin)

Gene Names
ABO; GTB; NAGAT; A3GALNT; A3GALT1
Applications
Western Blot
Purity
Purified
Synonyms
ABO; Monoclonal Antibody; ABO (ABO Blood Group (Transferase A; alpha 1-3-N-acetylgalactosaminylTransferase; Transferase B; alpha 1-3-galactosylTransferase); A3GALNT; A3GALT1; GTB; NAGAT) (Biotin); ABO Blood Group (Transferase A; NAGAT; anti-ABO antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B7
Specificity
Recognizes ABO.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ABO antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ABO (NP_065202.2, 273aa-354aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ABO monoclonal antibody (M08), clone 1B7. Western Blot analysis of ABO expression in A-431.)

Western Blot (WB) (ABO monoclonal antibody (M08), clone 1B7. Western Blot analysis of ABO expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged ABO is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ABO is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-ABO antibody
This gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in an individual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-ABO antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
28
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
histo-blood group ABO system transferase
NCBI Official Synonym Full Names
ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
NCBI Official Symbol
ABO
NCBI Official Synonym Symbols
GTB; NAGAT; A3GALNT; A3GALT1
NCBI Protein Information
histo-blood group ABO system transferase; ABO A3 transferase; ABO glycosyltransferase; ABO weak transfer; B(A) alpha-1,3-galactosyltransferase; fucosylglycoprotein 3-alpha-galactosyltransferase; fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase;
UniProt Protein Name
Histo-blood group ABO system transferase
UniProt Gene Name
ABO
UniProt Synonym Gene Names
A transferase; B transferase
UniProt Entry Name
BGAT_HUMAN

NCBI Description

This gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in an individual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ABO: This protein is the basis of the ABO blood group system. The histo-blood group ABO involves three carbohydrate antigens: A, B, and H. A, B, and AB individuals express a glycosyltransferase activity that converts the H antigen to the A antigen (by addition of UDP-GalNAc) or to the B antigen (by addition of UDP-Gal), whereas O individuals lack such activity. Belongs to the glycosyltransferase 6 family.

Protein type: Glycan Metabolism - glycosphingolipid biosynthesis - lacto and neolacto series; EC 2.4.1.37; Membrane protein, integral; EC 2.4.1.40; Transferase

Chromosomal Location of Human Ortholog: 9q34.2

Cellular Component: integral to membrane; extracellular region

Molecular Function: metal ion binding; glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity; fucosylgalactoside 3-alpha-galactosyltransferase activity

Biological Process: protein amino acid glycosylation

Disease: Blood Group, Abo System

Research Articles on ABO

Similar Products

Product Notes

The ABO abo (Catalog #AAA6174208) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ABO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ABO abo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABO, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.