Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human ABL2 Monoclonal Antibody | anti-ABL2 antibody

ABL2 (Tyrosine-protein Kinase ABL2, Abelson Murine Leukemia Viral Oncogene Homolog 2, Abelson-related Gene Protein, Tyrosine Kinase ARG, ABLL, ARG) (AP)

Gene Names
ABL2; ARG; ABLL
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ABL2; Monoclonal Antibody; ABL2 (Tyrosine-protein Kinase ABL2; Abelson Murine Leukemia Viral Oncogene Homolog 2; Abelson-related Gene Protein; Tyrosine Kinase ARG; ABLL; ARG) (AP); anti-ABL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6D5
Specificity
Recognizes human ABL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1167
Applicable Applications for anti-ABL2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa743-842 from human ABL2 (AAH65912) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(ABL2 monoclonal antibody Western Blot analysis of ABL2 expression in Hela NE.)

Western Blot (WB) (ABL2 monoclonal antibody Western Blot analysis of ABL2 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of ABL2 expression in transfected 293T cell line by ABL2 monoclonal antibody. Lane 1: ABL2 transfected lysate (126.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ABL2 expression in transfected 293T cell line by ABL2 monoclonal antibody. Lane 1: ABL2 transfected lysate (126.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ABL2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ABL2 is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between NCK1 and ABL2. HeLa cells were stained with NCK1 rabbit purified polyclonal 1:1200 and ABL2 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between NCK1 and ABL2. HeLa cells were stained with NCK1 rabbit purified polyclonal 1:1200 and ABL2 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Western Blot (WB)

(Western blot analysis of ABL2 over-expressed 293 cell line, cotransfected with ABL2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ABL2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of ABL2 over-expressed 293 cell line, cotransfected with ABL2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ABL2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-ABL2 antibody
ABL2 is a cytoplasmic tyrosine kinase which is closely related to but distinct from ABL1. The similarity of the proteins includes the tyrosine kinase domains and extends amino-terminal to include the SH2 and SH3 domains. ABL2 is expressed in both normal and tumor cells.
Product Categories/Family for anti-ABL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
27
NCBI Official Full Name
ABL2 protein
NCBI Official Synonym Full Names
ABL proto-oncogene 2, non-receptor tyrosine kinase
NCBI Official Symbol
ABL2
NCBI Official Synonym Symbols
ARG; ABLL
NCBI Protein Information
tyrosine-protein kinase ABL2

NCBI Description

This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Nov 2009]

Research Articles on ABL2

Similar Products

Product Notes

The ABL2 (Catalog #AAA6129821) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ABL2 (Tyrosine-protein Kinase ABL2, Abelson Murine Leukemia Viral Oncogene Homolog 2, Abelson-related Gene Protein, Tyrosine Kinase ARG, ABLL, ARG) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABL2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ABL2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.