Mouse ABL2 Monoclonal Antibody | anti-ABL2 antibody

ABL2 (v-abl Abelson murine Leukemia Viral OncoGene Homolog 2 (arg, Abelson-Related Gene), ABLL, ARG, FLJ22224, FLJ31718, FLJ41441) (Biotin)

Cat. Num. AAA6171419

• Gene Names: ABL2; ARG; ABLL
• Applications: Western Blot
• Purity: Purified
• Synonyms: ABL2; Monoclonal Antibody; ABL2 (v-abl Abelson murine Leukemia Viral OncoGene Homolog 2 (arg; Abelson-Related Gene); ABLL; ARG; FLJ22224; FLJ31718; FLJ41441) (Biotin); v-abl Abelson murine Leukemia Viral OncoGene Homolog 2 (arg; FLJ41441; anti-ABL2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 5C7
• Specificity: Recognizes ABL2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1167

• Applicable Applications for anti-ABL2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ABL2 (AAH65912, 743aa-842aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
• Conjugate: Biotin
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ABL2 monoclonal antibody (M08), clone 5C7 Western Blot analysis of ABL2 expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged ABL2 is approximately 0.03ng/ml as a capture antibody.)

Related Product Information for anti-ABL2 antibody

This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinase. The protein is highly similar to the ABL1 protein, including the tyrosine kinase, SH2 and SH3 domains, and has a role in cytoskeletal rearrangements by its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ETV6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-ABL2 antibody

Antibodies; Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 42406387
• NCBI GeneID: 27
• NCBI Official Full Name: ABL2 protein
• NCBI Official Synonym Full Names: ABL proto-oncogene 2, non-receptor tyrosine kinase
• NCBI Official Symbol: ABL2
• NCBI Official Synonym Symbols: ARG; ABLL
• NCBI Protein Information: tyrosine-protein kinase ABL2
• Protein Family: Abelson tyrosine-protein kinase

NCBI Description

This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Nov 2009]