Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ABCF1 is 3ng/ml as a capture antibody)

Mouse anti-Human ABCF1 Monoclonal Antibody | anti-ABCF1 antibody

ABCF1 (ATP-binding Cassette Sub-family F Member 1, ATP-binding Cassette 50, TNF-alpha-stimulated ABC Protein, ABC50) (PE)

Gene Names
ABCF1; ABC27; ABC50
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ABCF1; Monoclonal Antibody; ABCF1 (ATP-binding Cassette Sub-family F Member 1; ATP-binding Cassette 50; TNF-alpha-stimulated ABC Protein; ABC50) (PE); anti-ABCF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B4
Specificity
Recognizes human ABCF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
807
Applicable Applications for anti-ABCF1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa642-739 from human ABCF1 (NP_001081) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIES
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ABCF1 is 3ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged ABCF1 is 3ng/ml as a capture antibody)
Product Categories/Family for anti-ABCF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
23
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ATP-binding cassette sub-family F member 1 isoform b
NCBI Official Synonym Full Names
ATP binding cassette subfamily F member 1
NCBI Official Symbol
ABCF1
NCBI Official Synonym Symbols
ABC27; ABC50
NCBI Protein Information
ATP-binding cassette sub-family F member 1
UniProt Protein Name
ATP-binding cassette sub-family F member 1
Protein Family
UniProt Gene Name
ABCF1
UniProt Synonym Gene Names
ABC50
UniProt Entry Name
ABCF1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process. [provided by RefSeq, Jul 2008]

Uniprot Description

ABCF1: Isoform 2 is required for efficient Cap- and IRES- mediated mRNA translation initiation. Isoform 2 is not involved in the ribosome biogenesis. Belongs to the ABC transporter superfamily. ABCF family. EF3 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Translation; RNA-binding

Chromosomal Location of Human Ortholog: 6p21.33

Cellular Component: nucleoplasm; polysomal ribosome; membrane; cytoplasm; ribosome; nuclear envelope

Molecular Function: protein binding; translation activator activity; translation factor activity, nucleic acid binding; ATPase activity; ribosome binding; ATP binding

Biological Process: positive regulation of translation; translation; ribosome biogenesis and assembly; translational initiation; inflammatory response

Research Articles on ABCF1

Similar Products

Product Notes

The ABCF1 abcf1 (Catalog #AAA6156330) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ABCF1 (ATP-binding Cassette Sub-family F Member 1, ATP-binding Cassette 50, TNF-alpha-stimulated ABC Protein, ABC50) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABCF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ABCF1 abcf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABCF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.