Mouse anti-Human 2019-03-09 Monoclonal Antibody | anti-MARCH9 antibody

MARCH9 (E3 Ubiquitin-protein Ligase MARCH9, Membrane-associated RING Finger Protein 9, Membrane-associated RING-CH Protein IX, MARCH-IX, RING Finger Protein 179, RNF179, FLJ36578, MARCH-IX) (HRP)

Cat. Num. AAA6153440

• Gene Names: MARCH9; RNF179; MARCH-IX
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: 2019-03-09; Monoclonal Antibody; MARCH9 (E3 Ubiquitin-protein Ligase MARCH9; Membrane-associated RING Finger Protein 9; Membrane-associated RING-CH Protein IX; MARCH-IX; RING Finger Protein 179; RNF179; FLJ36578; MARCH-IX) (HRP); anti-MARCH9 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Clone Number: 2B5
• Specificity: Recognizes human MARCH9.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-MARCH9 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa240-346 from human MARCH9 (NP_612405) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTT
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.77kD).)

Testing Data

(Detection limit for recombinant GST tagged MARCH9 is 3ng/ml as a capture antibody.)

Related Product Information for anti-MARCH9 antibody

MARCH9 belongs to the membrane associated RING-CH (MARCH) family of genes which encode a novel group of RING-type ubiquitin E3 ligases. It is the first ubiquitin E3 ligase to control expression of the critical cell adhesion molecule ICAM-1. The expression of the protein causes ubiquitination and downregulation of ICAM-1. A short alternative transcript of MARCH9 lacking the RING-CH domain, termed MARCH9 RINGless, is shown to act as a positive regulator of MARCH9 activity. Overexpression of the protein, leads to downregulation of cell surface major histocompatibility complex (MHC) class I and CD4. Human MARCH9 gene maps to chromosome 12q14.1.

Product Categories/Family for anti-MARCH9 antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 40255016
• NCBI GeneID: 92979
• NCBI Accession #: NP_612405.2
• NCBI GenBank Nucleotide #: NM_138396
• UniProt Accession #: Q86YJ5; Q86VN5; Q96GG2; B2R9U9
• Molecular Weight: 37,772 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase MARCH9
• NCBI Official Synonym Full Names: membrane-associated ring finger (C3HC4) 9
• NCBI Official Symbol: MARCH9
• NCBI Official Synonym Symbols: RNF179; MARCH-IX
• NCBI Protein Information: E3 ubiquitin-protein ligase MARCH9; RING finger protein 179; membrane-associated RING-CH protein IX; membrane-associated RING finger protein 9
• UniProt Protein Name: E3 ubiquitin-protein ligase MARCH9
• UniProt Gene Name: MARCH9
• UniProt Synonym Gene Names: RNF179; MARCH-IX
• UniProt Entry Name: MARH9_HUMAN