Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.92kD).)

Mouse 2019-03-07 Monoclonal Antibody | anti-MARCH7 antibody

MARCH7 (E3 Ubiquitin-protein Ligase MARCH7, Axotrophin, Membrane-associated RING Finger Protein 7, Membrane-associated RING-CH Protein VII, MARCH-VII, RING Finger Protein 177, AXOT, RNF177, DKFZp586F1122) (FITC)

Gene Names
MARCH7; AXO; AXOT; RNF177; MARCH-VII
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
2019-03-07; Monoclonal Antibody; MARCH7 (E3 Ubiquitin-protein Ligase MARCH7; Axotrophin; Membrane-associated RING Finger Protein 7; Membrane-associated RING-CH Protein VII; MARCH-VII; RING Finger Protein 177; AXOT; RNF177; DKFZp586F1122) (FITC); anti-MARCH7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B9
Specificity
Recognizes human MARCH7. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-MARCH7 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa66-137 from human MARCH7 (NP_073737) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WYSESEITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWRHSQVPRSSSMVLGSFG
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.92kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.92kD).)

Western Blot (WB)

(MARCH7 monoclonal antibody. Western Blot analysis of 'MARCH7 expression in Raw 264.7.)

Western Blot (WB) (MARCH7 monoclonal antibody. Western Blot analysis of 'MARCH7 expression in Raw 264.7.)

Western Blot (WB)

(MARCH7 monoclonal antibody, Western Blot analysis of MARCH7expression in K-562.)

Western Blot (WB) (MARCH7 monoclonal antibody, Western Blot analysis of MARCH7expression in K-562.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MARCH7 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MARCH7 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged MARCH7 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MARCH7 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(MARCH7 monoclonal antibody. Western Blot analysis of 'MARCH7 expression in PC-12.)

Western Blot (WB) (MARCH7 monoclonal antibody. Western Blot analysis of 'MARCH7 expression in PC-12.)
Product Categories/Family for anti-MARCH7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase MARCH7 isoform a
NCBI Official Synonym Full Names
membrane associated ring-CH-type finger 7
NCBI Official Symbol
MARCH7
NCBI Official Synonym Symbols
AXO; AXOT; RNF177; MARCH-VII
NCBI Protein Information
E3 ubiquitin-protein ligase MARCH7
UniProt Protein Name
E3 ubiquitin-protein ligase MARCH7
UniProt Gene Name
MARCH7
UniProt Synonym Gene Names
AXOT; RNF177; MARCH-VII
UniProt Entry Name
MARH7_HUMAN

NCBI Description

MARCH7 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH proteins add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments (Bartee et al., 2004 [PubMed 14722266]).[supplied by OMIM, Mar 2010]

Uniprot Description

MARCH7: E3 ubiquitin-protein ligase which may specifically enhance the E2 activity of HIP2. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Protein type: EC 6.3.2.19; Ubiquitin conjugating system; Ubiquitin ligase; EC 6.3.2.-; Ligase

Chromosomal Location of Human Ortholog: 2q24.2

Molecular Function: zinc ion binding; ligase activity

Biological Process: protein ubiquitination

Research Articles on MARCH7

Similar Products

Product Notes

The MARCH7 march7 (Catalog #AAA6148136) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MARCH7 (E3 Ubiquitin-protein Ligase MARCH7, Axotrophin, Membrane-associated RING Finger Protein 7, Membrane-associated RING-CH Protein VII, MARCH-VII, RING Finger Protein 177, AXOT, RNF177, DKFZp586F1122) (FITC) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's 2019-03-07 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MARCH7 march7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "2019-03-07, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.