Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human 2019-03-05 Monoclonal Antibody | anti-MARCH5 antibody

MARCH5 (RNF153, E3 Ubiquitin-protein Ligase MARCH5, Membrane-associated RING Finger Protein 5, Membrane-associated RING-CH Protein V, Mitochondrial Ubiquitin Ligase, RING Finger Protein 153, FLJ20445, MARCH-V) (MaxLight 490)

Gene Names
MARCH5; MITOL; RNF153; MARCH-V
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
2019-03-05; Monoclonal Antibody; MARCH5 (RNF153; E3 Ubiquitin-protein Ligase MARCH5; Membrane-associated RING Finger Protein 5; Membrane-associated RING-CH Protein V; Mitochondrial Ubiquitin Ligase; RING Finger Protein 153; FLJ20445; MARCH-V) (MaxLight 490); anti-MARCH5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C3
Specificity
Recognizes human MARCH5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-MARCH5 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-96 from human MARCH5 (NP_060294) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISK
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MARCH5 antibody
MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2; MIM 608507) and DRP1 (DNM1L; MIM 603850) (Nakamura et al., 2006 [PubMed 16936636]).
Product Categories/Family for anti-MARCH5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,232 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase MARCH5
NCBI Official Synonym Full Names
membrane-associated ring finger (C3HC4) 5
NCBI Official Symbol
MARCH5
NCBI Official Synonym Symbols
MITOL; RNF153; MARCH-V
NCBI Protein Information
E3 ubiquitin-protein ligase MARCH5; membrane-associated RING finger protein 5; membrane-associated RING-CH protein V; mitochondrial ubiquitin ligase; ring finger protein 153
UniProt Protein Name
E3 ubiquitin-protein ligase MARCH5
UniProt Gene Name
MARCH5
UniProt Synonym Gene Names
RNF153; MARCH-V; MITOL
UniProt Entry Name
MARH5_HUMAN

Uniprot Description

MARCH5: Mitochondrial E3 ubiquitin-protein ligase that plays a crucial role in the control of mitochondrial morphology by acting as a positive regulator of mitochondrial fission. May play a role in the prevention of cell senescence acting as a regulator of mitochondrial quality control. Promotes ubiquitination of FIS1, DNM1L and MFN1.

Protein type: EC 6.3.2.-; Membrane protein, multi-pass; Ubiquitin ligase; Ligase; Membrane protein, integral; EC 6.3.2.19; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 10q23.32-q23.33

Cellular Component: mitochondrial outer membrane; endoplasmic reticulum membrane; membrane; endoplasmic reticulum; integral to membrane

Molecular Function: GTPase binding; protein binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: protein autoubiquitination; protein polyubiquitination

Similar Products

Product Notes

The MARCH5 march5 (Catalog #AAA6201763) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MARCH5 (RNF153, E3 Ubiquitin-protein Ligase MARCH5, Membrane-associated RING Finger Protein 5, Membrane-associated RING-CH Protein V, Mitochondrial Ubiquitin Ligase, RING Finger Protein 153, FLJ20445, MARCH-V) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's 2019-03-05 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MARCH5 march5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "2019-03-05, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.