Mouse anti-Human 2019-03-05 Monoclonal Antibody | anti-MARCH5 antibody

MARCH5 (RNF153, E3 Ubiquitin-protein Ligase MARCH5, Membrane-associated RING Finger Protein 5, Membrane-associated RING-CH Protein V, Mitochondrial Ubiquitin Ligase, RING Finger Protein 153, FLJ20445, MARCH-V) APC

Cat. Num. AAA6137528

• Gene Names: MARCH5; MITOL; RNF153; MARCH-V
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: 2019-03-05; Monoclonal Antibody; MARCH5 (RNF153; E3 Ubiquitin-protein Ligase MARCH5; Membrane-associated RING Finger Protein 5; Membrane-associated RING-CH Protein V; Mitochondrial Ubiquitin Ligase; RING Finger Protein 153; FLJ20445; MARCH-V) APC; anti-MARCH5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3C3
• Specificity: Recognizes human MARCH5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-MARCH5 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-96 from human MARCH5 (NP_060294) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISK
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MARCH5 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-MARCH5 antibody

MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2; MIM 608507) and DRP1 (DNM1L; MIM 603850) (Nakamura et al., 2006 [PubMed 16936636]).

Product Categories/Family for anti-MARCH5 antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 8923415
• NCBI GeneID: 54708
• NCBI Accession #: NP_060294
• NCBI GenBank Nucleotide #: NM_017824
• UniProt Accession #: Q9NX47
• Molecular Weight: 31,232 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase MARCH5
• NCBI Official Synonym Full Names: membrane-associated ring finger (C3HC4) 5
• NCBI Official Symbol: MARCH5
• NCBI Official Synonym Symbols: MITOL; RNF153; MARCH-V
• NCBI Protein Information: E3 ubiquitin-protein ligase MARCH5; membrane-associated RING finger protein 5; membrane-associated RING-CH protein V; mitochondrial ubiquitin ligase; ring finger protein 153
• UniProt Protein Name: E3 ubiquitin-protein ligase MARCH5
• UniProt Gene Name: MARCH5
• UniProt Synonym Gene Names: RNF153; MARCH-V; MITOL
• UniProt Entry Name: MARH5_HUMAN

Uniprot Description

MARCH5: Mitochondrial E3 ubiquitin-protein ligase that plays a crucial role in the control of mitochondrial morphology by acting as a positive regulator of mitochondrial fission. May play a role in the prevention of cell senescence acting as a regulator of mitochondrial quality control. Promotes ubiquitination of FIS1, DNM1L and MFN1.

Protein type: EC 6.3.2.-; Membrane protein, multi-pass; Ubiquitin ligase; Ligase; Membrane protein, integral; EC 6.3.2.19; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 10q23.32-q23.33

Cellular Component: mitochondrial outer membrane; endoplasmic reticulum membrane; membrane; endoplasmic reticulum; integral to membrane

Molecular Function: GTPase binding; protein binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: protein autoubiquitination; protein polyubiquitination