Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human 2019-03-03 Monoclonal Antibody | anti-MARCH3 antibody

MARCH3 (RNF173, E3 Ubiquitin-protein Ligase MARCH3, Membrane-associated RING Finger Protein 3, Membrane-associated RING-CH Protein III, RING Finger Protein 173, FLJ20096, MARCH-III, MGC48332) (FITC)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
2019-03-03; Monoclonal Antibody; MARCH3 (RNF173; E3 Ubiquitin-protein Ligase MARCH3; Membrane-associated RING Finger Protein 3; Membrane-associated RING-CH Protein III; RING Finger Protein 173; FLJ20096; MARCH-III; MGC48332) (FITC); anti-MARCH3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F6
Specificity
Recognizes human MARCH3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
253
Applicable Applications for anti-MARCH3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human MARCH3 (NP_848545) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLATQSPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSC
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)
Related Product Information for anti-MARCH3 antibody
MARCH3 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH proteins add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH3 appears to function in the endosomal recycling pathway (Fukuda et al., 2006 [PubMed 16428329]).
Product Categories/Family for anti-MARCH3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
E3 ubiquitin-protein ligase MARCH3
UniProt Protein Name
E3 ubiquitin-protein ligase MARCH3
UniProt Gene Name
MARCH3
UniProt Synonym Gene Names
RNF173; MARCH-III
UniProt Entry Name
MARH3_HUMAN

Uniprot Description

MARCH3: E3 ubiquitin-protein ligase which may be involved in endosomal trafficking. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Protein type: Membrane protein, integral; EC 6.3.2.-; Membrane protein, multi-pass; Ubiquitin conjugating system; Ubiquitin ligase; Ligase; EC 6.3.2.19

Chromosomal Location of Human Ortholog: 5q23.2

Cellular Component: cytoplasmic vesicle membrane; lysosome; early endosome membrane; integral to membrane; endosome

Molecular Function: zinc ion binding; ligase activity

Biological Process: protein ubiquitination; endocytosis

Similar Products

Product Notes

The MARCH3 march3 (Catalog #AAA6148133) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MARCH3 (RNF173, E3 Ubiquitin-protein Ligase MARCH3, Membrane-associated RING Finger Protein 3, Membrane-associated RING-CH Protein III, RING Finger Protein 173, FLJ20096, MARCH-III, MGC48332) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's 2019-03-03 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MARCH3 march3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "2019-03-03, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.