Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human 2019-03-01 Monoclonal Antibody | anti-MARCH1 antibody

MARCH1 (E3 Ubiquitin-protein Ligase MARCH1, Membrane-associated RING Finger Protein 1, Membrane-associated RING-CH Protein I, MARCH-I, RING Finger Protein 171, RNF171, DKFZp564M1682, FLJ20668) (MaxLight 750)

Gene Names
MARCH1; RNF171; MARCH-I
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
2019-03-01; Monoclonal Antibody; MARCH1 (E3 Ubiquitin-protein Ligase MARCH1; Membrane-associated RING Finger Protein 1; Membrane-associated RING-CH Protein I; MARCH-I; RING Finger Protein 171; RNF171; DKFZp564M1682; FLJ20668) (MaxLight 750); anti-MARCH1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D2
Specificity
Recognizes human MARCH1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-MARCH1 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human MARCH1 (NP_060393) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTSSHVCCNFLNMWKKSKISTMYYLNQDAKLSNLFLQASSPTTGTAPRSQSRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIK
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MARCH1 antibody
E3 ubiquitin-protein ligase that mediates ubiquitination of TFRC, CD86, FAS and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. By constitutively ubiquitinating MHC class II proteins in immature dendritic cells, down-regulates their cell surface localization thus sequestering them in the intracellular endosomal system.
Product Categories/Family for anti-MARCH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase MARCH1 isoform 2
NCBI Official Synonym Full Names
membrane associated ring-CH-type finger 1
NCBI Official Symbol
MARCH1
NCBI Official Synonym Symbols
RNF171; MARCH-I
NCBI Protein Information
E3 ubiquitin-protein ligase MARCH1
UniProt Protein Name
E3 ubiquitin-protein ligase MARCH1
UniProt Gene Name
MARCH1
UniProt Synonym Gene Names
RNF171; MARCH-I
UniProt Entry Name
MARH1_HUMAN

NCBI Description

MARCH1 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH proteins add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH1 downregulates the surface expression of major histocompatibility complex (MHC) class II molecules (see MIM 142880) and other glycoproteins by directing them to the late endosomal/lysosomal compartment (Bartee et al., 2004 [PubMed 14722266]; Thibodeau et al., 2008 [PubMed 18389477]; De Gassart et al., 2008 [PubMed 18305173]).[supplied by OMIM, Mar 2010]

Uniprot Description

MARCH1: E3 ubiquitin-protein ligase that mediates ubiquitination of TFRC, CD86, FAS and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. By constitutively ubiquitinating MHC class II proteins in immature dendritic cells, down-regulates their cell surface localization thus sequestering them in the intracellular endosomal system. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Ligase; Membrane protein, multi-pass; Ubiquitin ligase; EC 6.3.2.19; Ubiquitin conjugating system; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 4q32.2

Cellular Component: endoplasmic reticulum membrane; cytoplasmic vesicle membrane; lysosomal membrane; lysosome; late endosome membrane; early endosome membrane; integral to membrane; plasma membrane; trans-Golgi network membrane; endosome

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; MHC protein binding; ligase activity

Biological Process: protein polyubiquitination; antigen processing and presentation of peptide antigen via MHC class II; immune response

Research Articles on MARCH1

Similar Products

Product Notes

The MARCH1 march1 (Catalog #AAA6233785) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MARCH1 (E3 Ubiquitin-protein Ligase MARCH1, Membrane-associated RING Finger Protein 1, Membrane-associated RING-CH Protein I, MARCH-I, RING Finger Protein 171, RNF171, DKFZp564M1682, FLJ20668) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's 2019-03-01 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MARCH1 march1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "2019-03-01, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.