Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Myelin Oligodendrocyte Glycoprotein Recombinant Protein | MOG recombinant protein

Recombinant Human Myelin Oligodendrocyte Glycoprotein

Gene Names
MOG; BTN6; BTNL11; MOGIG2; NRCLP7
Purity
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Myelin Oligodendrocyte Glycoprotein; Recombinant Human Myelin Oligodendrocyte Glycoprotein; MOG Human; Myelin Oligodendrocyte Glycoprotein Human Recombinant; MOG; MOGIG-2; MGC26137; MOG recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
The Myelin Oligodendrocyte Glycoprotein 0.5mg/ml solution was lyophilized from 20mM sodium acetate buffer pH-4 and 0.3M sodium chloride.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH
Sequence Length
224
Application Notes
5-20ug per ml for In-Vitro Experiments and 50-100up per animal for In-Vitro study. The protein can be used for T-cell proliferation, cytokine induction, antigen presentation, Western Blotting, ELISA and EAE induction in mice.
Solubility
It is recommended to reconstitute the lyophilized MOG in sterile 10mM Acetic acid not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution MOG should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for MOG recombinant protein
Description: Myelin Oligodendrocyte Glycoprotein produced in E Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.

Introduction: Myelin Oligodendrocyte Glycoprotein is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a prime target antigen that plays a role in immune-mediated demyelination. Myelin Oligodendrocyte Glycoprotein is involved in completion and maintenance of the myelin sheath and in cell-cell communication. MOG protein was found to differentially expressed in the dorsolateral prefrontal cortex and in the temporal lobe from patients with schizophrenia. MOG-specific antibody is crucial to the initiation of MOG-induced murine experimental autoimmune encephalomyelitis.
Product Categories/Family for MOG recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33,528 Da
NCBI Official Full Name
myelin-oligodendrocyte glycoprotein isoform alpha3
NCBI Official Synonym Full Names
myelin oligodendrocyte glycoprotein
NCBI Official Symbol
MOG
NCBI Official Synonym Symbols
BTN6; BTNL11; MOGIG2; NRCLP7
NCBI Protein Information
myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5
UniProt Protein Name
Myelin-oligodendrocyte glycoprotein
UniProt Gene Name
MOG
UniProt Entry Name
MOG_HUMAN

NCBI Description

The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

MOG: Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell- cell communication. Defects in MOG are the cause of narcolepsy type 7 (NRCLP7). Neurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed. Belongs to the immunoglobulin superfamily. BTN/MOG family. 10 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p22.1

Cellular Component: plasma membrane; integral to membrane

Biological Process: central nervous system development; positive regulation of MyD88-dependent toll-like receptor signaling pathway; cell adhesion

Disease: Narcolepsy 7

Research Articles on MOG

Similar Products

Product Notes

The MOG mog (Catalog #AAA143269) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. 5-20ug per ml for In-Vitro Experiments and 50-100up per animal for In-Vitro study. The protein can be used for T-cell proliferation, cytokine induction, antigen presentation, Western Blotting, ELISA and EAE induction in mice. Researchers should empirically determine the suitability of the MOG mog for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGQFRVIGPR HPIRALVGDE VELPCRISPG KNATGMEVGW YRPPFSRVVH LYRNGKDQDG DQAPEYRGRT ELLKDAIGEG KVTLRIRNVR FSDEGGFTCF FRDHSYQEEA AMELKVEDPF YWVSPGHHHH HH. It is sometimes possible for the material contained within the vial of "Myelin Oligodendrocyte Glycoprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.