Molybdate-binding periplasmic protein (modA) Recombinant Protein | modA recombinant protein

Recombinant Escherichia coli Molybdate-binding periplasmic protein (modA)

Cat. Num. AAA1126185

• Gene Names: modA; ECK0752; JW0746
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Molybdate-binding periplasmic protein (modA); Recombinant Escherichia coli Molybdate-binding periplasmic protein (modA); modA recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 25-257, full length protein
• Sequence: DEGKITVFAAASLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTIK
• Sequence Length: 233

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16128731
• NCBI GeneID: 945364
• NCBI Accession #: NP_415284.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P37329
• Molecular Weight: 27,364 Da
• NCBI Official Full Name: molybdate ABC transporter periplasmic binding protein; chlorate resistance protein
• NCBI Official Symbol: modA
• NCBI Official Synonym Symbols: ECK0752; JW0746
• NCBI Protein Information: molybdate ABC transporter periplasmic binding protein; chlorate resistance protein
• UniProt Protein Name: Molybdate-binding protein ModA
• Protein Family: Molybdate-binding protein
• UniProt Gene Name: modA

NCBI Description

Flagellar regulon. [More information is available at EcoGene: EG12427]. ModA is the periplasmic binding component of the molybdate ABC transporter. [More information is available at EcoCyc: EG12427].

Uniprot Description

Part of the ABC transporter complex ModABC involved in the transport of molybdenum into the cell (PubMed:8576221). Binds molybdate with high affinity in vitro and with a similar affinity in vivo (PubMed:21861186, PubMed:28150901, PubMed:9545596, PubMed:8576221, PubMed:21784948, PubMed:8409926). Binds tungstate with high affinity in vitro (PubMed:28150901, PubMed:9545596, PubMed:8576221, PubMed:21784948). Binds unnatural anion perrhenate with high affinity in vitro (PubMed:21861186). Does not bind sulfate, phosphate, arsenate, selenate, chlorate, metavanadate, nitrate, perchlorate, permanganate or carbonate (PubMed:9545596, PubMed:28150901, PubMed:8576221).