Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

UPF0059 membrane protein yebN (yebN) Recombinant Protein | yebN recombinant protein

Recombinant Escherichia coli UPF0059 membrane protein yebN (yebN)

Gene Names
yebN; ECK1819; JW5830
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UPF0059 membrane protein yebN (yebN); Recombinant Escherichia coli UPF0059 membrane protein yebN (yebN); Recombinant UPF0059 membrane protein yebN (yebN); UPF0059 membrane protein yebN; yebN recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-188
Sequence
MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGMLASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQILWTHFHG
Sequence Length
188
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,117 Da
NCBI Official Full Name
conserved inner membrane protein
NCBI Official Symbol
yebN
NCBI Official Synonym Symbols
ECK1819; JW5830
NCBI Protein Information
conserved inner membrane protein
UniProt Protein Name
Probable manganese efflux pump MntP
UniProt Gene Name
mntP
UniProt Synonym Gene Names
yebN
UniProt Entry Name
MNTP_ECOLI

NCBI Description

YebN is an inner membrane protein with five predicted transmembrane domains. [More information is available at EcoCyc: G6999].

Uniprot Description

Function: Probably functions as a manganese efflux pump. Ref.6

Subcellular location: Cell inner membrane; Multi-pass membrane protein HAMAP-Rule MF_01521.

Induction: Up-regulated by MntR in response to manganese. Ref.6

Disruption phenotype: Deletion causes manganese sensitivity and leads to increased intracellular manganese levels. Ref.6

Sequence similarities: Belongs to the MntP (TC 9.B.29) family. [View classification]

Similar Products

Product Notes

The yebN mntp (Catalog #AAA1119071) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-188. The amino acid sequence is listed below: MNITATVLLA FGMSMDAFAA SIGKGATLHK PKFSEALRTG LIFGAVETLT PLIGWGMGML ASRFVLEWNH WIAFVLLIFL GGRMIIEGFR GADDEDEEPR RRHGFWLLVT TAIATSLDAM AVGVGLAFLQ VNIIATALAI GCATLIMSTL GMMVGRFIGS IIGKKAEILG GLVLIGIGVQ ILWTHFHG. It is sometimes possible for the material contained within the vial of "UPF0059 membrane protein yebN (yebN), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual