Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Stromelysin-1 (MMP3) Recombinant Protein | MMP3 recombinant protein

Recombinant Dog Stromelysin-1 (MMP3)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Stromelysin-1 (MMP3); Recombinant Dog Stromelysin-1 (MMP3); MMP3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
100-478, Full length protein
Sequence
FTTFPGMPKWRKTHLTYRIMNYTPDLPRDAVDSAIEKALNVWKEVTPLTFSRTDEGEADIKISFAVRDHGDFNPFDGPGNVLGHAYPPGPGIYGDAHFDDDEQWTSDTSGTNLFLVAAHELGHSLGLFHSADPSALMYPVYNVLADLARFHLSQDDVNGIQSLYGGPPSDSSNDPVVPTESVPPGPGTPAACDPTLSFDAISTLRGEFLFFKDRHFWRKSLRTLEPGFYLISSFWPSLPSGLDAAYEETSKDIVFIFKGNQFWAMRGTEVQAGYPKGIHTLGFPPTVKKIDAAVFDKEKKKTYFFVGDKYWRFDEKRQSMEPGFPKQIAEDFPGVDSKVDAAFEAFGFYYFFNGSSQLEFDPNAKKVTHVLKSNSWLNC
Sequence Length
379
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MMP3 recombinant protein
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP s are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,633 Da
NCBI Official Full Name
stromelysin-1
NCBI Official Symbol
MMP3
NCBI Protein Information
stromelysin-1
UniProt Protein Name
Stromelysin-1
Protein Family
UniProt Gene Name
MMP3
UniProt Synonym Gene Names
SL-1; MMP-3

Uniprot Description

Can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. Activates procollagenase ().

Research Articles on MMP3

Similar Products

Product Notes

The MMP3 mmp3 (Catalog #AAA1302656) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 100-478, Full length protein. The amino acid sequence is listed below: FTTFPGMPKW RKTHLTYRIM NYTPDLPRDA VDSAIEKALN VWKEVTPLTF SRTDEGEADI KISFAVRDHG DFNPFDGPGN VLGHAYPPGP GIYGDAHFDD DEQWTSDTSG TNLFLVAAHE LGHSLGLFHS ADPSALMYPV YNVLADLARF HLSQDDVNGI QSLYGGPPSD SSNDPVVPTE SVPPGPGTPA ACDPTLSFDA ISTLRGEFLF FKDRHFWRKS LRTLEPGFYL ISSFWPSLPS GLDAAYEETS KDIVFIFKGN QFWAMRGTEV QAGYPKGIHT LGFPPTVKKI DAAVFDKEKK KTYFFVGDKY WRFDEKRQSM EPGFPKQIAE DFPGVDSKVD AAFEAFGFYY FFNGSSQLEF DPNAKKVTHV LKSNSWLNC. It is sometimes possible for the material contained within the vial of "Stromelysin-1 (MMP3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.