Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Membrane magnesium transporter 1 Recombinant Protein | Mmgt1 recombinant protein

Membrane magnesium transporter 1

Gene Names
Mmgt1; Tmem32; RGD1566339
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Membrane magnesium transporter 1; Mmgt1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-131aa; full length protein
Sequence
AFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDATNSSNLDALSSNTSLKLRKFDSLRR
Sequence Length
Full Length Protein
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Mmgt1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Mmgt1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,677 Da
NCBI Official Full Name
membrane magnesium transporter 1
NCBI Official Synonym Full Names
membrane magnesium transporter 1
NCBI Official Symbol
Mmgt1
NCBI Official Synonym Symbols
Tmem32; RGD1566339
NCBI Protein Information
membrane magnesium transporter 1
UniProt Protein Name
Membrane magnesium transporter 1
UniProt Gene Name
Mmgt1
UniProt Entry Name
MMGT1_RAT

Uniprot Description

TMEM32: Mediates Mg(2+) transport. Belongs to the membrane magnesium transporter (TC 1.A.67) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Membrane protein, integral; Endoplasmic reticulum

Cellular Component: cytoplasm; early endosome; Golgi apparatus; integral to membrane; membrane; plasma membrane

Molecular Function: cobalt ion transmembrane transporter activity; ferrous iron transmembrane transporter activity; inorganic cation transmembrane transporter activity; magnesium ion transmembrane transporter activity

Biological Process: cation transport; cobalt ion transport; copper ion transport; ferrous iron transport; magnesium ion transport

Similar Products

Product Notes

The Mmgt1 mmgt1 (Catalog #AAA7043091) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-131aa; full length protein. The amino acid sequence is listed below: AFSAAQHRSY MRLTEKEDES LPIDIVLQTL LAFAVTCYGI VHIAGEFKDM DATSELKNKT FDTLRNHPSF YVFNHRGRVL FRPSDATNSS NLDALSSNTS LKLRKFDSLR R. It is sometimes possible for the material contained within the vial of "Membrane magnesium transporter 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.