Monocyte to macrophage differentiation factor 2 (MMD2) Recombinant Protein | MMD2 recombinant protein

Recombinant Human Monocyte to macrophage differentiation factor 2 (MMD2)

Cat. Num. AAA7020394

• Gene Names: MMD2; PAQR10
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Monocyte to macrophage differentiation factor 2 (MMD2); Recombinant Human Monocyte to macrophage differentiation factor 2 (MMD2); MMD2 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-270aa; full length protein
• Sequence: MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFLS DDDWETISAWIYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCLHMFDRMVIYFFIAASYA PWLNLRELGPWASHMRWLVWIMASVGTIYVFFFHERTGSCVQFLRGEACPKAGTACLPAR YKLVELLCYVVMGFFPALVILSMPNTEGIWELVTGGVFYCLGMVFFKSDGRIPFAHAIWH LFVAFGAGTHYYAIWRYLYLPSTLQTKVSK
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Human
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for MMD2 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 154759277
• NCBI GeneID: 221938
• NCBI Accession #: NP_001094070.1
• NCBI GenBank Nucleotide #: NM_001100600.1
• UniProt Accession #: Q8IY49; Q6NVU5; Q6TCH0; B5MBW4
• Molecular Weight: 22,730 Da
• NCBI Official Full Name: monocyte to macrophage differentiation factor 2 isoform 1
• NCBI Official Synonym Full Names: monocyte to macrophage differentiation associated 2
• NCBI Official Symbol: MMD2
• NCBI Official Synonym Symbols: PAQR10
• NCBI Protein Information: monocyte to macrophage differentiation factor 2
• UniProt Protein Name: Monocyte to macrophage differentiation factor 2
• Protein Family: Monocyte to macrophage differentiation factor
• UniProt Gene Name: MMD2
• UniProt Synonym Gene Names: PAQR10
• UniProt Entry Name: PAQRA_HUMAN

NCBI Description

This gene encodes a member of the PAQR (progestin and adipoQ receptor) family. Members of this family are evolutionarily conserved with significant sequence identity to bacterial hemolysin-like proteins and are defined by a set of seven transmembrane domains. The protein encoded by this gene localizes to the Golgi apparatus to modulate Ras signaling. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jun 2012]

Uniprot Description

MMD2: a member of the PAQR (progestin and adipoQ receptor) family. Members of this family are evolutionarily conserved with significant sequence identity to bacterial hemolysin-like proteins and are defined by a set of seven transmembrane domains. The protein encoded by this gene localizes to the Golgi apparatus to modulate Ras signaling. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jun 2012]

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7p22.1

Cellular Component: Golgi membrane; integral to membrane; perinuclear region of cytoplasm

Molecular Function: protein kinase activity

Biological Process: positive regulation of neuron differentiation; positive regulation of protein kinase activity; positive regulation of Ras protein signal transduction; protein amino acid phosphorylation; regulation of protein localization