Membrane protein insertase MisCB (misCB) Recombinant Protein | misCB recombinant protein
Recombinant Bacillus subtilis Membrane protein insertase MisCB (misCB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Membrane protein insertase MisCB (misCB); Recombinant Bacillus subtilis Membrane protein insertase MisCB (misCB); misCB recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
19-275aa; full length protein
Sequence
CSGNAAFAATNQVGGLSNVGFFHDYLIEPFSALLKGVAGLFHGEYGLSIILVTIIVRIVV LPLFVNQFKKQRIFQEKMAVIKPQVDSIQVKLKKTKDPEKQKELQMEMMKLYQEHNINPL AMGCLPMLIQSPIMIGLYYAIRSTPEIASHSFLWFSLGQSDILMSLSAGIMYFVQAYIAQ KLSAKYSAVPQNPAAQQSAKLMVFIFPVMMTIFSLNVPAALPLYWFTSGLFLTVQNIVLQ MTHHKSKKTAALTESVK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for misCB recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,748 Da
NCBI Official Full Name
membrane protein insertase MisCB
NCBI Official Symbol
yqjG
NCBI Protein Information
membrane protein insertase MisCB
UniProt Protein Name
Membrane protein insertase MisCB
Protein Family
UniProt Gene Name
misCB
UniProt Synonym Gene Names
yqjG
UniProt Entry Name
MISCB_BACSU
Uniprot Description
Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins (). Also involved in protein secretion processes. It has an overlapping, although partly distinct, function compared to SpoIIIJ(MisCB).
Research Articles on misCB
Similar Products
Product Notes
The misCB miscb (Catalog #AAA7020366) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-275aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the misCB miscb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CSGNAAFAAT NQVGGLSNVG FFHDYLIEPF SALLKGVAGL FHGEYGLSII LVTIIVRIVV LPLFVNQFKK QRIFQEKMAV IKPQVDSIQV KLKKTKDPEK QKELQMEMMK LYQEHNINPL AMGCLPMLIQ SPIMIGLYYA IRSTPEIASH SFLWFSLGQS DILMSLSAGI MYFVQAYIAQ KLSAKYSAVP QNPAAQQSAK LMVFIFPVMM TIFSLNVPAA LPLYWFTSGL FLTVQNIVLQ MTHHKSKKTA ALTESVK. It is sometimes possible for the material contained within the vial of "Membrane protein insertase MisCB (misCB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
