Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EF-hand domain-containing family member A1 (EFHA1) Recombinant Protein | EFHA1 recombinant protein

Recombinant Human EF-hand domain-containing family member A1 (EFHA1)

Gene Names
MICU2; EFHA1; 1110008L20Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
EF-hand domain-containing family member A1 (EFHA1); Recombinant Human EF-hand domain-containing family member A1 (EFHA1); EFHA1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-434, Full length protein
Sequence
MAAAAGSCARVAAWGGKLRRGLAVSRQAVRSPGPLAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQTAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVAFKMLDTDGNEMIEKREFFKLQKIISKQDDLMTVKTNETGYQEAIVKEPEINTTLQMRFFGKRGQRKLHYKEFRRFMENLQTEIQEMEFLQFSKGLSFMRKEDFAEWLLFFTNTENKDIYWKNVREKLSAGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQELSNNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWVPQHQSIQEYWKCVKKESIKGVKEVWKQAGKGLF
Sequence Length
434
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,666 Da
NCBI Official Full Name
calcium uptake protein 2, mitochondrial
NCBI Official Synonym Full Names
mitochondrial calcium uptake 2
NCBI Official Symbol
MICU2
NCBI Official Synonym Symbols
EFHA1; 1110008L20Rik
NCBI Protein Information
calcium uptake protein 2, mitochondrial
UniProt Protein Name
Calcium uptake protein 2, mitochondrial
UniProt Gene Name
MICU2
UniProt Synonym Gene Names
EFHA1

Uniprot Description

Key regulator of mitochondrial calcium uniporter (MCU) required to limit calcium uptake by MCU when cytoplasmic calcium is low (PubMed:24503055, PubMed:24560927, PubMed:26903221). MICU1 and MICU2 form a disulfide-linked heterodimer that stimulate and inhibit MCU activity, depending on the concentration of calcium (PubMed:24560927). MICU2 acts as a gatekeeper of MCU that senses calcium level via its EF-hand domains: prevents channel opening at resting calcium, avoiding energy dissipation and cell-death triggering (PubMed:24560927).

Research Articles on EFHA1

Similar Products

Product Notes

The EFHA1 micu2 (Catalog #AAA1355073) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-434, Full length protein. The amino acid sequence is listed below: MAAAAGSCAR VAAWGGKLRR GLAVSRQAVR SPGPLAAAVA GAALAGAGAA WHHSRVSVAA RDGSFTVSAQ KNVEHGIIYI GKPSLRKQRF MQFSSLEHEG EYYMTPRDFL FSVMFEQMER KTSVKKLTKK DIEDTLSGIQ TAGCGSTFFR DLGDKGLISY TEYLFLLTIL TKPHSGFHVA FKMLDTDGNE MIEKREFFKL QKIISKQDDL MTVKTNETGY QEAIVKEPEI NTTLQMRFFG KRGQRKLHYK EFRRFMENLQ TEIQEMEFLQ FSKGLSFMRK EDFAEWLLFF TNTENKDIYW KNVREKLSAG ESISLDEFKS FCHFTTHLED FAIAMQMFSL AHRPVRLAEF KRAVKVATGQ ELSNNILDTV FKIFDLDGDE CLSHEEFLGV LKNRMHRGLW VPQHQSIQEY WKCVKKESIK GVKEVWKQAG KGLF. It is sometimes possible for the material contained within the vial of "EF-hand domain-containing family member A1 (EFHA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.