Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mitochondrial intermembrane space import and assembly protein 40 (MIA40) Recombinant Protein | CaO19.10494 recombinant protein

Recombinant Candida albicans Mitochondrial intermembrane space import and assembly protein 40 (MIA40)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial intermembrane space import and assembly protein 40 (MIA40); Recombinant Candida albicans Mitochondrial intermembrane space import and assembly protein 40 (MIA40); Recombinant Mitochondrial intermembrane space import and assembly protein 40 (MIA40); Mitochondrial intermembrane space import and assembly protein 40; Mitochondrial import inner membrane translocase TIM40; CaO19.10494 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
32-252
Sequence
SQYNSKLLLGVLGTGALAFGYFSQQSSLIQNASTAENIEKVFEEGNAVAKDAQESLDARQEKVIKENEQKTKKAEDAKTSSESKANVADKKSNSQPEGEPEGEGKQEAAFNPDTGEINWDCPCLGGMAHGPCGEEFKEAFSCFVFSETEPKGIDCIKKFENMRSCFKRYPEHYKDELYDDGEEEASTEVVEHVVLETSEPAIEQIEQGIKEDKVKPNTKSD
Sequence Length
252
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,930 Da
NCBI Official Full Name
potential mitochondrial protein
NCBI Official Symbol
CaO19.10494
NCBI Protein Information
similar to internal region of S. cerevisiae essential mitochondrial protein FMP15 (YKL195W); same as cosmid orf Ca49C10.16; potential mitochondrial protein
UniProt Protein Name
Mitochondrial intermembrane space import and assembly protein 40
UniProt Gene Name
MIA40
UniProt Synonym Gene Names
TIM40
UniProt Entry Name
MIA40_CANAL

Uniprot Description

Function: Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Forms a redox cycle with ERV1 that involves a disulfide relay system. Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS

By similarity.

Cofactor: Copper or zinc

By similarity.

Subunit structure: Monomer

By similarity.

Subcellular location: Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side

By similarity.

Domain: The CHCH domain contains a conserved twin Cys-X(9)-Cys motif which is required for import and stability of MIA40 in mitochondria

By similarity.

Sequence similarities: Contains 1 CHCH domain.

Similar Products

Product Notes

The CaO19.10494 mia40 (Catalog #AAA1159330) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 32-252. The amino acid sequence is listed below: SQYNSKLLLG VLGTGALAFG YFSQQSSLIQ NASTAENIEK VFEEGNAVAK DAQESLDARQ EKVIKENEQK TKKAEDAKTS SESKANVADK KSNSQPEGEP EGEGKQEAAF NPDTGEINWD CPCLGGMAHG PCGEEFKEAF SCFVFSETEP KGIDCIKKFE NMRSCFKRYP EHYKDELYDD GEEEASTEVV EHVVLETSEP AIEQIEQGIK EDKVKPNTKS D. It is sometimes possible for the material contained within the vial of "Mitochondrial intermembrane space import and assembly protein 40 (MIA40), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.