Bifunctional lycopene cyclase/phytoene synthase Recombinant Protein | MGYG_02096 recombinant protein
Recombinant Arthroderma gypseum Bifunctional lycopene cyclase/phytoene synthase (MGYG_02096)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bifunctional lycopene cyclase/phytoene synthase; Recombinant Arthroderma gypseum Bifunctional lycopene cyclase/phytoene synthase (MGYG_02096); MGYG_02096 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-594aa; full length protein
Sequence
MGLDYLMVHVKYNLPPALLLTILYKPFFTRLEVHKIVLLCTIAVVWTIPWDSYLIRTRIW SYPADSVLGQTLFQIPLEEVFFFIIQTYNTSLLYIIFNKRLVLPSYLSGPTKPLAQGLFG PITHRTQRDLGTLFFTGILILGISFIYIGGEYMYLGLILSWVSPILVMQWVLMYRFLLAL PPASVWVPIALPTLYLWVVDTLALRRGTWVIESGTKVDIQLWEGLEIEEALFFLVTNVMV VFGIAAMHNAAALFEYKAFISTTAMGDTPSIYQLITLFLTSSRLYDTNVLQEMSQAVTLL KQKSQSMYLGSAMFEGQLRLDLIALYSFCRKADDLIDDAPDRETAKYWIEQCEKALELRF KLKETALDDTEAYQLLTKSIPQPLHAAAHLLPASRLPKEPLSCLLQGFEIDLKFDFEKGS FPIATEHDLEVYAYHVAGTVASLLLELVFRHHPVSISEAERLRVISAGEVMGRALQYTNI ARDITRDAEIGRVYIPSSWLAEEGLTPSMVISHPRNSKLIPLRRRILEKADKCYCETQEA ISKLPSNVQGPVRATVTAYMEIGQVIRENETKIWNGKLKVSRWRRFKRAWLAML
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) (Microsporum gypseum)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for MGYG_02096 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67,784 Da
NCBI Official Full Name
phytoene synthase
NCBI Official Symbol
MGYG_02096
NCBI Protein Information
phytoene synthase
UniProt Protein Name
Bifunctional lycopene cyclase/phytoene synthase
Protein Family
UniProt Gene Name
MGYG_02096
UniProt Entry Name
LCPS_ARTGP
Uniprot Description
Bifunctional enzyme that catalyzes the reactions from geranylgeranyl diphosphate to phytoene (phytoene synthase) and lycopene to beta-carotene via the intermediate gamma-carotene (lycopene cyclase).
Similar Products
Product Notes
The MGYG_02096 mgyg_02096 (Catalog #AAA7036504) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-594aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the MGYG_02096 mgyg_02096 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGLDYLMVHV KYNLPPALLL TILYKPFFTR LEVHKIVLLC TIAVVWTIPW DSYLIRTRIW SYPADSVLGQ TLFQIPLEEV FFFIIQTYNT SLLYIIFNKR LVLPSYLSGP TKPLAQGLFG PITHRTQRDL GTLFFTGILI LGISFIYIGG EYMYLGLILS WVSPILVMQW VLMYRFLLAL PPASVWVPIA LPTLYLWVVD TLALRRGTWV IESGTKVDIQ LWEGLEIEEA LFFLVTNVMV VFGIAAMHNA AALFEYKAFI STTAMGDTPS IYQLITLFLT SSRLYDTNVL QEMSQAVTLL KQKSQSMYLG SAMFEGQLRL DLIALYSFCR KADDLIDDAP DRETAKYWIE QCEKALELRF KLKETALDDT EAYQLLTKSI PQPLHAAAHL LPASRLPKEP LSCLLQGFEI DLKFDFEKGS FPIATEHDLE VYAYHVAGTV ASLLLELVFR HHPVSISEAE RLRVISAGEV MGRALQYTNI ARDITRDAEI GRVYIPSSWL AEEGLTPSMV ISHPRNSKLI PLRRRILEKA DKCYCETQEA ISKLPSNVQG PVRATVTAYM EIGQVIRENE TKIWNGKLKV SRWRRFKRAW LAML. It is sometimes possible for the material contained within the vial of "Bifunctional lycopene cyclase/phytoene synthase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
