Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Methionine import system permease protein MetP (metP) Recombinant Protein | metP recombinant protein

Recombinant Bacillus subtilis Methionine import system permease protein MetP (metP)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Methionine import system permease protein MetP (metP); Recombinant Bacillus subtilis Methionine import system permease protein MetP (metP); Recombinant Methionine import system permease protein MetP (metP); Methionine import system permease protein MetP; metP recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-222
Sequence
MFEKYFPNVDLTELWNATYETLYMTLISLLFAFVIGVILGLLLFLTSKGSLWQNKAVNSVIAAVVNIFRSIPFLILIILLLGFTKFLVGTILGPNAALPALVIGSAPFYARLVEIALREVDKGVIEAAKSMGAKTSTIIFKVLIPESMPALISGITVTAIALIGSTAIAGAIGSGGLGNLAYVEGYQSNNADVTFVATVFILIIVFIIQIIGDLITNIIDKR
Sequence Length
222
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,756 Da
NCBI Official Full Name
methionine ABC transporter permease
NCBI Official Symbol
metP
NCBI Protein Information
methionine ABC transporter permease
UniProt Protein Name
Methionine import system permease protein MetP
UniProt Gene Name
metP
UniProt Synonym Gene Names
yusB
UniProt Entry Name
METP_BACSU

Uniprot Description

Function: Part of the ABC transporter complex MetNPQ involved in methionine import. Responsible for the translocation of the substrate across the membrane

Probable. It has also been shown to be involved in methionine sulfoxide transport. Ref.2

Subunit structure: The complex is composed of two ATP-binding proteins (MetN), two transmembrane proteins (MetP) and a solute-binding protein (MetQ)

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein

Potential.

Induction: Repressed by methionine via the S-box system. Ref.2

Sequence similarities: Belongs to the binding-protein-dependent transport system permease family. CysTW subfamily.Contains 1 ABC transmembrane type-1 domain.

Similar Products

Product Notes

The metP metp (Catalog #AAA1111812) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-222. The amino acid sequence is listed below: MFEKYFPNVD LTELWNATYE TLYMTLISLL FAFVIGVILG LLLFLTSKGS LWQNKAVNSV IAAVVNIFRS IPFLILIILL LGFTKFLVGT ILGPNAALPA LVIGSAPFYA RLVEIALREV DKGVIEAAKS MGAKTSTIIF KVLIPESMPA LISGITVTAI ALIGSTAIAG AIGSGGLGNL AYVEGYQSNN ADVTFVATVF ILIIVFIIQI IGDLITNIID KR. It is sometimes possible for the material contained within the vial of "Methionine import system permease protein MetP (metP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.