Mediator of RNA polymerase II transcription subunit 7 (MED7) Recombinant Protein | MED7 recombinant protein
Recombinant Pig Mediator of RNA polymerase II transcription subunit 7 (MED7)
Gene Names
MED7; CRSP9
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mediator of RNA polymerase II transcription subunit 7 (MED7); Recombinant Pig Mediator of RNA polymerase II transcription subunit 7 (MED7); MED7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-233, Full length protein
Sequence
MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKAEPMDADDSNNCTGQSDQQRENSGHRRDQIIEKDAALCVLIDEMNERP
Sequence Length
233
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MED7 recombinant protein
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. This protein is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,165 Da
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 7
NCBI Official Symbol
MED7
NCBI Official Synonym Symbols
CRSP9
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 7
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 7
Protein Family
UniProt Gene Name
MED7
UniProt Synonym Gene Names
CRSP9; CRSP complex subunit 9
Uniprot Description
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors ().
Research Articles on MED7
Similar Products
Product Notes
The MED7 med7 (Catalog #AAA1326734) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-233, Full length protein. The amino acid sequence is listed below: MGEPQQVSAL PPPPMQYIKE YTDENIQEGL APKPPPPIKD SYMMFGNQFQ CDDLIIRPLE SQGIERLHPM QFDHKKELRK LNMSILINFL DLLDILIRSP GSIKREEKLE DLKLLFVHVH HLINEYRPHQ ARETLRVMME VQKRQRLETA ERFQKHLERV IEMIQNCLAS LPDDLPHSEA GMRVKAEPMD ADDSNNCTGQ SDQQRENSGH RRDQIIEKDA ALCVLIDEMN ERP. It is sometimes possible for the material contained within the vial of "Mediator of RNA polymerase II transcription subunit 7 (MED7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
