Malate dehydrogenase, cytoplasmic (Mdh1) Recombinant Protein | Mdh1 recombinant protein
Recombinant Mouse Malate dehydrogenase, cytoplasmic (Mdh1)
Gene Names
Mdh1; MDHA; Mor2; MDH-s; Mor-2; D17921; B230377B03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Malate dehydrogenase; cytoplasmic (Mdh1); Recombinant Mouse Malate dehydrogenase; Mdh1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-334, Full length protein
Sequence
SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEIAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGTALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAIADHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFLSSA
Sequence Length
333
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Mdh1 recombinant protein
Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD
NADH cofactor system in the citric acid cycle. This protein is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.
NADH cofactor system in the citric acid cycle. This protein is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36,511 Da
NCBI Official Full Name
malate dehydrogenase, peroxisomal isoform Mdh1x
NCBI Official Synonym Full Names
malate dehydrogenase 1, NAD (soluble)
NCBI Official Symbol
Mdh1
NCBI Official Synonym Symbols
MDHA; Mor2; MDH-s; Mor-2; D17921; B230377B03Rik
NCBI Protein Information
malate dehydrogenase, cytoplasmic; malate dehydrogenase, peroxisomal
UniProt Protein Name
Malate dehydrogenase, cytoplasmic
Protein Family
UniProt Gene Name
Mdh1
UniProt Synonym Gene Names
Mor2
NCBI Description
This gene encodes an enzyme that catalyzes the NAD/NADH-dependent, reversible oxidation of malate to oxaloacetate in many metabolic pathways, including the citric acid cycle. Two main isozymes are known to exist in eukaryotic cells: one is found in the mitochondrial matrix and the other in the cytoplasm. This gene encodes the cytosolic isozyme, which plays a key role in the malate-aspartate shuttle that allows malate to pass through the mitochondrial membrane to be transformed into oxaloacetate for further cellular processes. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. A pseudogene has been identified on chromosomes 12. [provided by RefSeq, Feb 2016]
Research Articles on Mdh1
Similar Products
Product Notes
The Mdh1 mdh1 (Catalog #AAA948963) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-334, Full length protein. The amino acid sequence is listed below: SEPIRVLVTG AAGQIAYSLL YSIGNGSVFG KDQPIILVLL DITPMMGVLD GVLMELQDCA LPLLQDVIAT DKEEIAFKDL DVAVLVGSMP RREGMERKDL LKANVKIFKS QGTALEKYAK KSVKVIVVGN PANTNCLTAS KSAPSIPKEN FSCLTRLDHN RAKSQIALKL GVTADDVKNV IIWGNHSSTQ YPDVNHAKVK LQGKEVGVYE ALKDDSWLKG EFITTVQQRG AAVIKARKLS SAMSAAKAIA DHIRDIWFGT PEGEFVSMGV ISDGNSYGVP DDLLYSFPVV IKNKTWKFVE GLPINDFSRE KMDLTAKELT EEKETAFEFL SSA. It is sometimes possible for the material contained within the vial of "Malate dehydrogenase, cytoplasmic (Mdh1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
