Myelin basic protein (MBP) Recombinant Protein | MBP recombinant protein

Recombinant Pan troglodytes Myelin basic protein (MBP)

Cat. Num. AAA1072010

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Myelin basic protein (MBP); Recombinant Pan troglodytes Myelin basic protein (MBP); MBP recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-171, Full length protein
• Sequence: ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSGHRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGAQDAQGTLSKIFKLGGRDSRSGSPMARR
• Sequence Length: 171

• Species: Pan troglodytes (Chimpanzee)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 126802
• UniProt Accession #: P06906
• Molecular Weight: 18,560 Da
• NCBI Official Full Name: Myelin basic protein
• UniProt Protein Name: Myelin basic protein
• Protein Family: Myelin basic protein
• UniProt Gene Name: MBP
• UniProt Synonym Gene Names: MBP

Uniprot Description

Is, with PLP, the most abundant protein component of the myelin membrane in the CNS. Has a role in both the formation and stabilization of this compact multilayer arrangement of bilayers. Each splice variant and charge isomer may have a specialized function in the assembly of an optimized, biochemically functional myelin membrane ().