SDS-PAGE
Myelin basic protein Recombinant Protein | EGM_08965 recombinant protein
Recombinant Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) Myelin basic protein
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Myelin basic protein; Recombinant Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) Myelin basic protein; Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey); EGM_08965 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-304aa; Full Length
Sequence
MGNHAGKRELNTEKASTNGETNRGESEKKTNLGELSRTTSEDSEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGVPKRGSGKDSHHAARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGVDAQGTLSRIFKLGGRDSRSGSPMARR
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Product Categories/Family for EGM_08965 recombinant protein
References
"Genome sequencing and comparison of two nonhuman primate animal models, the cynomolgus and Chinese rhesus macaques."
Yan G., Zhang G., Fang X., Zhang Y., Li C., Ling F., Cooper D.N., Li Q., Li Y., van Gool A.J., Du H., Chen J., Chen R., Zhang P., Huang Z., Thompson J.R., Meng Y., Bai Y. Wang J.
Nat. Biotechnol. 29:1019-1023(2011)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Symbol
MBP
NCBI Protein Information
myelin basic protein
UniProt Protein Name
Myelin basic protein
Protein Family
UniProt Gene Name
EGM_08965
UniProt Entry Name
G7PWA0_MACFA
Similar Products
Product Notes
The EGM_08965 egm_08965 (Catalog #AAA969653) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-304aa; Full Length. The amino acid sequence is listed below: MGNHAGKREL NTEKASTNGE TNRGESEKKT NLGELSRTTS EDSEVFGEAD ANQNNGTSSQ DTAVTDSKRT ADPKNAWQDA HPADPGSRPH LIRLFSRDAP GREDNTFKDR PSESDELQTI QEDSAATSES LDVMASQKRP SQRHGSKYLA TASTMDHARH GFLPRHRDTG ILDSIGRFFG GDRGVPKRGS GKDSHHAART AHYGSLPQKS HGRTQDENPV VHFFKNIVTP RTPPPSQGKG RGLSLSRFSW GAEGQKPGFG YGGRASDYKS AHKGFKGVDA QGTLSRIFKL GGRDSRSGSP MARR . It is sometimes possible for the material contained within the vial of "Myelin basic protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
