Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human MBL2/MBL/COLEC1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 30-35 kDa.)

MBL2/MBL/COLEC1 Recombinant Protein | MBL2 recombinant protein

Recombinant Human MBL2/MBL/COLEC1 Protein

Gene Names
MBL2; MBL; MBP; MBP1; MBPD; MBL2D; MBP-C; COLEC1; HSMBPC
Purity
>97% by SDS-PAGE.
Synonyms
MBL2/MBL/COLEC1; Recombinant Human MBL2/MBL/COLEC1 Protein; COLEC1; HSMBPC; MBL; MBL2D; MBP; MBP-C; MBP1; MBPD; MBL2 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
Sequence Length
248
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human MBL2/MBL/COLEC1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 30-35 kDa.)

SDS-Page (Recombinant Human MBL2/MBL/COLEC1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 30-35 kDa.)
Related Product Information for MBL2 recombinant protein
Description: Recombinant Human MBL2/MBL/COLEC1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu21-Ile248) of human MBL2/MBL/COLEC1 (Accession #NP_000233.1) fused with a 6xHis tag at the C-terminus.

Background: This protein is soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
Product Categories/Family for MBL2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
mannose-binding protein C
NCBI Official Synonym Full Names
mannose binding lectin 2
NCBI Official Symbol
MBL2
NCBI Official Synonym Symbols
MBL; MBP; MBP1; MBPD; MBL2D; MBP-C; COLEC1; HSMBPC
NCBI Protein Information
mannose-binding protein C
UniProt Protein Name
Mannose-binding protein C
Protein Family
UniProt Gene Name
MBL2
UniProt Synonym Gene Names
COLEC1; MBL; MBP-C
UniProt Entry Name
MBL2_HUMAN

NCBI Description

This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases. [provided by RefSeq, Jul 2008]

Uniprot Description

MBL2: Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 10q11.2

Cellular Component: extracellular space; cell surface; collagen; extracellular region

Molecular Function: mannose binding; protein binding; calcium ion binding; calcium-dependent protein binding; receptor binding

Biological Process: defense response to Gram-positive bacterium; killing by host of symbiont cells; positive regulation of phagocytosis; defense response to bacterium; acute-phase response; innate immune response; response to oxidative stress; opsonization; complement activation, lectin pathway; complement activation, classical pathway; negative regulation of viral reproduction; complement activation

Disease: Mannose-binding Protein Deficiency

Research Articles on MBL2

Similar Products

Product Notes

The MBL2 mbl2 (Catalog #AAA9139692) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: ETVTCEDAQK TCPAVIACSS PGINGFPGKD GRDGTKGEKG EPGQGLRGLQ GPPGKLGPPG NPGPSGSPGP KGQKGDPGKS PDGDSSLAAS ERKALQTEMA RIKKWLTFSL GKQVGNKFFL TNGEIMTFEK VKALCVKFQA SVATPRNAAE NGAIQNLIKE EAFLGITDEK TEGQFVDLTG NRLTYTNWNE GEPNNAGSDE DCVLLLKNGQ WNDVPCSTSH LAVCEFPI. It is sometimes possible for the material contained within the vial of "MBL2/MBL/COLEC1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.