MOB kinase activator-like 1 (mats) Recombinant Protein | mats recombinant protein

Recombinant Drosophila melanogaster MOB kinase activator-like 1 (mats)

Cat. Num. AAA1458170

• Gene Names: mats; anon-WO0118547.303; CG13852; DmelCG13852; dmob1; Dmob1; DMob1; Mats; Mob1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: MOB kinase activator-like 1 (mats); Recombinant Drosophila melanogaster MOB kinase activator-like 1 (mats); mats recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-219, Full length protein
• Sequence: MDFLFGSRSSKTFKPKKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFFNQINMLYGTITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELAPLQELIDKLTAKDERQI
• Sequence Length: 219

• Species: Drosophila melanogaster (Fruit fly)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 442620449
• NCBI GeneID: 42634
• NCBI Accession #: NP_001262835.1
• NCBI GenBank Nucleotide #: NM_001275906.1
• UniProt Accession #: Q95RA8; Q9VD10
• Molecular Weight: 25,229 Da
• NCBI Official Full Name: mob as tumor suppressor, isoform B
• NCBI Official Synonym Full Names: mob as tumor suppressor
• NCBI Official Symbol: mats
• NCBI Official Synonym Symbols: anon-WO0118547.303; CG13852; DmelCG13852; dmob1; Dmob1; DMob1; Mats; Mob1
• NCBI Protein Information: CG13852 gene product from transcript CG13852-RB
• UniProt Protein Name: MOB kinase activator-like 1
• Protein Family: MOB kinase activator
• UniProt Gene Name: mats
• UniProt Synonym Gene Names: Dmob1

Uniprot Description

Coactivator of Warts (Wts) kinase in the Hippo/SWH (Sav/Wts/Hpo)signaling pathway, a signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein Hippo (Hpo), in complex with its regulatory protein Salvador (Sav), phosphorylates and activates Warts (Wts) in complex with its regulatory protein Mats, which in turn phosphorylates and inactivates the Yorkie (Yki)oncoprotein. The Hippo/SWH signaling pathway inhibits the activity of the transcriptional complex formed by Scalloped (sd) and Yki and the target genes of this pathway include cyclin-E (cycE), diap1 and bantam. Mats is essential for early development and is required for proper chromosomal segregation in developing embryos.