Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase MARCH9 (MARCH9) Recombinant Protein | MARCH9 recombinant protein

Recombinant Human E3 ubiquitin-protein ligase MARCH9 (MARCH9)

Gene Names
MARCH9; RNF179; MARCH-IX
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase MARCH9 (MARCH9); Recombinant Human E3 ubiquitin-protein ligase MARCH9 (MARCH9); MARCH9 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-346aa; full length protein
Sequence
MLKSRLRMFLNELKLLVLTGGGRPRAEPQPRGGRGGGCGWAPFAGCSTRDGDGDEEEYYG SEPRARGLAGDKEPRAGPLPPPAPPLPPPGALDALSLSSSLDSGLRTPQCRICFQGPEQG ELLSPCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVI EKVQIAAIVLGSLFLVASISWLIWSSLSPSAKWQRQDLLFQICYGMYGFMDVVCIGLIIH EGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAGKSGPRNSRTGPTSGATSRPP AAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for MARCH9 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,873 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase MARCH9
NCBI Official Synonym Full Names
membrane associated ring-CH-type finger 9
NCBI Official Symbol
MARCH9
NCBI Official Synonym Symbols
RNF179; MARCH-IX
NCBI Protein Information
E3 ubiquitin-protein ligase MARCH9
UniProt Protein Name
E3 ubiquitin-protein ligase MARCH9
UniProt Gene Name
MARCH9
UniProt Synonym Gene Names
RNF179; MARCH-IX
UniProt Entry Name
MARH9_HUMAN

NCBI Description

MARCH9 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH9 induces internalization of several membrane glycoproteins and directs them to the endosomal compartment (Bartee et al., 2004 [PubMed 14722266]; Hoer et al., 2007 [PubMed 17174307]).[supplied by OMIM, Apr 2010]

Uniprot Description

MARCH9: E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I, CD4 and ICAM1, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; Ligase; Membrane protein, integral; Ubiquitin ligase; EC 6.3.2.19; Membrane protein, multi-pass; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 12q14.1

Cellular Component: Golgi membrane; Golgi stack; integral to membrane; lysosomal membrane; trans-Golgi network

Molecular Function: ligase activity; zinc ion binding

Biological Process: protein ubiquitination

Research Articles on MARCH9

Similar Products

Product Notes

The MARCH9 march9 (Catalog #AAA7006889) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-346aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the MARCH9 march9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLKSRLRMFL NELKLLVLTG GGRPRAEPQP RGGRGGGCGW APFAGCSTRD GDGDEEEYYG SEPRARGLAG DKEPRAGPLP PPAPPLPPPG ALDALSLSSS LDSGLRTPQC RICFQGPEQG ELLSPCRCDG SVRCTHQPCL IRWISERGSW SCELCYFKYQ VLAISTKNPL QWQAISLTVI EKVQIAAIVL GSLFLVASIS WLIWSSLSPS AKWQRQDLLF QICYGMYGFM DVVCIGLIIH EGSSVYRIFK RWQAVNQQWK VLNYDKTKDI GGDAGGGTAG KSGPRNSRTG PTSGATSRPP AAQRMRTLLP QRCGYTILHL LGQLRPPDAR SSSHSGREVV MRVTTV. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase MARCH9 (MARCH9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.