Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Dual specificity mitogen-activated protein kinase kinase 2 (Map2k2) Recombinant Protein | Map2k2 recombinant protein

Recombinant Mouse Dual specificity mitogen-activated protein kinase kinase 2 (Map2k2)

Gene Names
Map2k2; MK2; MEK2; Prkmk2; AA589381
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dual specificity mitogen-activated protein kinase kinase 2 (Map2k2); Recombinant Mouse Dual specificity mitogen-activated protein kinase kinase 2 (Map2k2); Map2k2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-401, full length protein
Sequence
MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELDLDEQQRKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRPPGRPISVGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERADLKLLMNHAFIKRSEGEEVDFAGWLCRTLRLKQPSTPTRTAV
Sequence Length
401
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Map2k2 recombinant protein
This protein is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1
ERK2 and MAPK2
ERK3. The activation of this kinase itself is dependent on the Ser
Thr phosphorylation by MAP kinase kinase kinases. Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,402 Da
NCBI Official Full Name
dual specificity mitogen-activated protein kinase kinase 2 isoform 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase 2
NCBI Official Symbol
Map2k2
NCBI Official Synonym Symbols
MK2; MEK2; Prkmk2; AA589381
NCBI Protein Information
dual specificity mitogen-activated protein kinase kinase 2
UniProt Protein Name
Dual specificity mitogen-activated protein kinase kinase 2
UniProt Gene Name
Map2k2
UniProt Synonym Gene Names
Mek2; Mkk2; Prkmk2; MAP kinase kinase 2; MAPKK 2; MEK 2

Uniprot Description

Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in a Thr-Glu-Tyr sequence located in MAP kinases. Activates the ERK1 and ERK2 MAP kinases.

Research Articles on Map2k2

Similar Products

Product Notes

The Map2k2 map2k2 (Catalog #AAA1415486) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-401, full length protein. The amino acid sequence is listed below: MLARRKPVLP ALTINPTIAE GPSPTSEGAS EANLVDLQKK LEELDLDEQQ RKRLEAFLTQ KAKVGELKDD DFERISELGA GNGGVVTKAR HRPSGLIMAR KLIHLEIKPA VRNQIIRELQ VLHECNSPYI VGFYGAFYSD GEISICMEHM DGGSLDQVLK EAKRIPEDIL GKVSIAVLRG LAYLREKHQI MHRDVKPSNI LVNSRGEIKL CDFGVSGQLI DSMANSFVGT RSYMSPERLQ GTHYSVQSDI WSMGLSLVEL AIGRYPIPPP DAKELEASFG RPVVDGADGE PHSVSPRPRP PGRPISVGHG MDSRPAMAIF ELLDYIVNEP PPKLPSGVFS SDFQEFVNKC LIKNPAERAD LKLLMNHAFI KRSEGEEVDF AGWLCRTLRL KQPSTPTRTA V. It is sometimes possible for the material contained within the vial of "Dual specificity mitogen-activated protein kinase kinase 2 (Map2k2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.