Mannose-6-phosphate isomerase Recombinant Protein | manA recombinant protein

Recombinant Escherichia coli Mannose-6-phosphate isomerase

Cat. Num. AAA1219003

• Gene Names: manA; ECK1608; JW1605; pmi
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mannose-6-phosphate isomerase; Recombinant Escherichia coli Mannose-6-phosphate isomerase; Phosphohexomutase; Phosphomannose isomerase; PMI; manA recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-391aa; Full Length
• Sequence: MQKLINSVQNYAWGSKTALTELYGMENPSSQPMAELWMGAHPKSSSRVQNAAGDIVSLRDVIESDKSTLLGEAVAKRFGELPFLFKVLCAAQPLSIQVHPNKHNSEIGFAKENAAGIPMDAAERNYKDPNHKPELVFALTPFLAMNAFREFSEIVSLLQPVAGAHPAIAHFLQQPDAERLSELFASLLNMQGEEKSRALAILKSALDSQQGEPWQTIRLISEFYPEDSGLFSPLLLNVVKLNPGEAMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELVANVKFEAKPANQLLTQPVKQGAELDFPIPVDDFAFSLHDLSDKETTISQQSAAILFCVEGDATLWKGSQQLQLKPGESAFIAANESPVTVKGHGRLARVYNKL
• Sequence Length: 391

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for manA recombinant protein

Involved in the conversion of glucose to GDP-L-fucose, which can be converted to L-fucose, a capsular polysaccharide.

References

Nucleotide sequence and transcriptional start point of the phosphomannose isomerase gene (manA) of Escherichia coli.Miles J.S., Guest J.R.Gene 32:41-48(1984) A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map.Aiba H., Baba T., Fujita K., Hayashi K., Inada T., Isono K., Itoh T., Kasai H., Kashimoto K., Kimura S., Kitakawa M., Kitagawa M., Makino K., Miki T., Mizobuchi K., Mori H., Mori T., Motomura K., Nakade S., Nakamura Y., Nashimoto H., Nishio Y., Oshima T., Saito N., Sampei G., Seki Y., Sivasundaram S., Tagami H., Takeda J., Takemoto K., Takeuchi Y., Wada C., Yamamoto Y., Horiuchi T.DNA Res. 3:363-377(1996) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Robison K., O'Keeffe T., Church G.M. Lysine acetylation is a highly abundant and evolutionarily conserved modification in Escherichia coli.Zhang J., Sprung R., Pei J., Tan X., Kim S., Zhu H., Liu C.F., Grishin N.V., Zhao Y.Mol. Cell. Proteomics 8:215-225(2009)

NCBI and Uniprot Product Information

• NCBI GI #: 49176125
• NCBI GeneID: 944840
• NCBI Accession #: NP_416130.3
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P00946
• Molecular Weight: 58.8 kDa
• NCBI Official Full Name: mannose-6-phosphate isomerase
• NCBI Official Symbol: manA
• NCBI Official Synonym Symbols: ECK1608; JW1605; pmi
• NCBI Protein Information: mannose-6-phosphate isomerase
• UniProt Protein Name: Mannose-6-phosphate isomerase
• Protein Family: Mannose-6-phosphate isomerase
• UniProt Gene Name: manA
• UniProt Synonym Gene Names: pmi; PMI
• UniProt Entry Name: MANA_ECOLI

NCBI Description

Mannose-6-phosphate isomerase (PMI) is required for growth on mannose as the sole source of carbon and energy. [More information is available at EcoCyc: EG10566].

Uniprot Description

Involved in the conversion of glucose to GDP-L-fucose, which can be converted to L-fucose, a capsular polysaccharide.