Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9) Active Protein | TNFRSF9 active protein
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9), Partial
Gene Names
TNFRSF9; ILA; 4-1BB; CD137; CDw137
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9); Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9); Partial; CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA; TNFRSF9 active protein
Host
Mammalian Cell
Specificity
Expressed on the surface of activated T-cells.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
Sequence Positions
24-186aa; Extracellular Domain
Sequence
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Sequence Length
255
Species
Human
Tag
C-terminal 6xHis-FC-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml.
Subcellular Location
Membrane, Single-Pass Type I Membrane Protein
Classification
Drug Target
Subdivision
Immune Checkpoint
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for TNFRSF9 active protein
Relevance: Tumor necrosis factor receptor superfamily member 9(TNFRSF9) is an inducible T cell surface protein belonging to the TNF receptor superfamily. It is a single-pass type I membrane protein which contains 4 TNFR-Cys repeats. The human and mouse proteins share 60% amino acid sequence identity. It is absent from naive T cells, but upregulated and continually expressed following T cell activation. It is a receptor for TNFSF9/4-1BBL, and possibly active during T cell activation.
Function: Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
Function: Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
Product Categories/Family for TNFRSF9 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44 kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 9
NCBI Official Synonym Full Names
TNF receptor superfamily member 9
NCBI Official Symbol
TNFRSF9
NCBI Official Synonym Symbols
ILA; 4-1BB; CD137; CDw137
NCBI Protein Information
tumor necrosis factor receptor superfamily member 9
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 9
Protein Family
UniProt Gene Name
TNFRSF9
UniProt Synonym Gene Names
CD137; ILA
UniProt Entry Name
TNR9_HUMAN
NCBI Description
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB. [provided by RefSeq, Jul 2008]
Uniprot Description
TNFRSF9: Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
Protein type: Membrane protein, integral; Receptor, misc.
Chromosomal Location of Human Ortholog: 1p36
Cellular Component: extracellular space; integral to plasma membrane; external side of plasma membrane
Molecular Function: cytokine binding; receptor activity
Biological Process: negative regulation of cell proliferation; apoptosis
Research Articles on TNFRSF9
Similar Products
Product Notes
The TNFRSF9 tnfrsf9 (Catalog #AAA7115110) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-186aa; Extracellular Domain. The amino acid sequence is listed below: LQDPCSNCPA GTFCDNNRNQ ICSPCPPNSF SSAGGQRTCD ICRQCKGVFR TRKECSSTSN AECDCTPGFH CLGAGCSMCE QDCKQGQELT KKGCKDCCFG TFNDQKRGIC RPWTNCSLDG KSVLVNGTKE RDVVCGPSPA DLSPGASSVT PPAPAREPGH SPQ. It is sometimes possible for the material contained within the vial of "Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
