Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data ()

CD137 recombinant protein

CD137 Recombinant Protein

Gene Names
TNFRSF9; ILA; 4-1BB; CD137; CDw137
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD137; CD137 Recombinant Protein; CD137 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
501
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Testing Data ()
Related Product Information for CD137 recombinant protein
Background: TNFRSF9 is a member of the tumor necrosis factor receptor superfamily. It is also called 4-1BB or CD137. 4-1BB/CD137/TNFRSF9 is expressed in activated CD4+ and CD8+ T cells, natural killer cells and dendritic cells. The ligand 4-1BBL/CD137L/TNFSF9 on antigen presenting cells binds to 4-1BB/CD137/TNFRSF9 and costimulates the activation of T cells. The binding of agonistic antibodies to 4-1BB/CD137/TNFRSF9 also leads to costimulation for T cell activation. Studies have shown the effectiveness of targeting 4-1BB/CD137/TNFRSF9 by its agonistic antibodies in cancer immunotherapy.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,899 Da
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 9
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 9
NCBI Official Symbol
TNFRSF9
NCBI Official Synonym Symbols
ILA; 4-1BB; CD137; CDw137
NCBI Protein Information
tumor necrosis factor receptor superfamily member 9; CD137 antigen; T cell antigen ILA; T-cell antigen ILA; 4-1BB ligand receptor; homolog of mouse 4-1BB; receptor protein 4-1BB; T-cell antigen 4-1BB homolog; induced by lymphocyte activation (ILA); interl
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 9
UniProt Gene Name
TNFRSF9
UniProt Synonym Gene Names
CD137; ILA
UniProt Entry Name
TNR9_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFRSF9: Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 1p36

Cellular Component: extracellular space; integral to plasma membrane; external side of plasma membrane

Molecular Function: cytokine binding; receptor activity

Biological Process: negative regulation of cell proliferation; apoptosis

Research Articles on CD137

Similar Products

Product Notes

The CD137 tnfrsf9 (Catalog #AAA3003907) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LQDPCSNCPA GTFCDNNRNQ ICSPCPPNSF SSAGGQRTCD ICRQCKGVFR TRKECSSTSN AECDCTPGFH CLGAGCSMCE QDCKQGQELT KKGCKDCCFG TFNDQKRGIC RPWTNCSLDG KSVLVNGTKE RDVVCGPSPA DLSPGASSVT PPAPAREPGH SPQ. It is sometimes possible for the material contained within the vial of "CD137, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.