Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) Active Protein | TNFRSF1B active protein

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B), Partial

Gene Names
TNFRSF1B; p75; TBPII; TNFBR; TNFR2; CD120b; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B); Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B); Partial; Tumor necrosis factor receptor superfamily member 1B; Tumor necrosis factor receptor 2; Tumor necrosis factor receptor type II; p75; p80 TNF-alpha receptor; TBP-2; TBPII; TNFRSF1B; TNFBR; TNFR2; TNFRSF1B active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
Sequence Positions
23-257aa; Extracellular Domain
Sequence
LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
Sequence Length
461
Species
Human
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit TNFa-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TNFa is less than 0.6 ug/mL.
Subcellular Location
Isoform 1: Cell Membrane, Single-Pass Type I Membrane Protein, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Tumor necrosis factor-binding protein 2: Secreted
Classification
Cytokine
Subdivision
Tumor Necrosis Factor
Pathway
TNF Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for TNFRSF1B active protein
Relevance: Tumor necrosis factor receptor superfamily member 1B is a 461 amino acids protein that belongs to the TNFR (tumor necrosis factor receptor) superfamily characterized by cysteine-rich extracellular domains. It contains 4 TNFR-Cys repeats. TNFRII is expressed in fetal brain. TNFRII is strongly expressed at the cartilage-pannus junction, and plays a major role in a subset of families with multiple cases of rheumatoid arthritis (RA). This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.

Function: Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
Product Categories/Family for TNFRSF1B active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.2 kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 1B
NCBI Official Synonym Full Names
TNF receptor superfamily member 1B
NCBI Official Symbol
TNFRSF1B
NCBI Official Synonym Symbols
p75; TBPII; TNFBR; TNFR2; CD120b; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II
NCBI Protein Information
tumor necrosis factor receptor superfamily member 1B
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 1B
UniProt Gene Name
TNFRSF1B
UniProt Synonym Gene Names
TNFBR; TNFR2; TNF-R2; TNF-RII; TNFR-II
UniProt Entry Name
TNR1B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. [provided by RefSeq, Jul 2008]

Uniprot Description

TNF-R2: Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity. Binds to TRAF2. Interacts with BMX. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: cell soma; perinuclear region of cytoplasm; extracellular region; integral to membrane; plasma membrane; nucleus; lipid raft

Molecular Function: protein binding; tumor necrosis factor receptor activity; ubiquitin protein ligase binding

Biological Process: DNA damage response, signal transduction resulting in induction of apoptosis; tumor necrosis factor-mediated signaling pathway; negative regulation of inflammatory response; immune response; RNA destabilization; inflammatory response; positive regulation of membrane protein ectodomain proteolysis; aging

Research Articles on TNFRSF1B

Similar Products

Product Notes

The TNFRSF1B tnfrsf1b (Catalog #AAA7115086) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-257aa; Extracellular Domain. The amino acid sequence is listed below: LPAQVAFTPY APEPGSTCRL REYYDQTAQM CCSKCSPGQH AKVFCTKTSD TVCDSCEDST YTQLWNWVPE CLSCGSRCSS DQVETQACTR EQNRICTCRP GWYCALSKQE GCRLCAPLRK CRPGFGVARP GTETSDVVCK PCAPGTFSNT TSSTDICRPH QICNVVAIPG NASMDAVCTS TSPTRSMAPG AVHLPQPVST RSQHTQPTPE PSTAPSTSFL LPMGPSPPAE GSTGD. It is sometimes possible for the material contained within the vial of "Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.