Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transforming Growth Factor beta-2 (TGFB2) Active Protein | TGFB2 active protein

Recombinant Human Transforming Growth Factor beta-2 (TGFB2)

Gene Names
TGFB2; LDS4; G-TSF; TGF-beta2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transforming Growth Factor beta-2 (TGFB2); Recombinant Human Transforming Growth Factor beta-2 (TGFB2); Transforming growth factor beta-2; TGFB2; Polyergin; G-TSF; Glioblastoma-derived T-cell suppressor factor; Cetermin; BSC-1 cell growth inhibitor; TGF-beta-2; TGFB2 active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 4 mM HCl
Sequence Positions
303-414aa; Full Length of Mature Protein
Sequence
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Sequence Length
442
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is less than 15 ng/ml.
Subcellular Location
Secreted
Protein Families
TGF-beta Family
Classification
Cytokine
Subdivision
Growth Factor
Pathway
Hippo Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for TGFB2 active protein
Relevance: Transforming growth factor beta-2 (TGF-beta2) is a secreted protein which belongs to the TGF-beta family. It is known as a cytokine that performs many cellular functions and has a vital role during embryonic development. The precursor is cleaved into mature TGF-beta-2 and LAP, which remains non-covalently linked to mature TGF-beta-2 rendering it inactive. It is an extracellular glycosylated protein. It is known to suppress the effects of interleukin dependent T-cell tumors. Defects in TGFB2 may be a cause of non-syndromic aortic disease (NSAD).

Function: TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.
Product Categories/Family for TGFB2 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12.7 kDa
NCBI Official Full Name
transforming growth factor beta-2 proprotein isoform 1
NCBI Official Synonym Full Names
transforming growth factor beta 2
NCBI Official Symbol
TGFB2
NCBI Official Synonym Symbols
LDS4; G-TSF; TGF-beta2
NCBI Protein Information
transforming growth factor beta-2 proprotein
UniProt Protein Name
Transforming growth factor beta-2
UniProt Gene Name
TGFB2
UniProt Synonym Gene Names
TGF-beta-2; G-TSF; LAP
UniProt Entry Name
TGFB2_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers. A chromosomal translocation that includes this gene is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. Mutations in this gene may be associated with Loeys-Dietz syndrome. This gene encodes multiple isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016]

Uniprot Description

TGFB2: TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth. Homodimer; disulfide-linked. Heterodimers with TGFB1 and with TGFB3 have been found in bone. Interacts with the serine proteases, HTRA1 and HTRA3. Interacts with ASPN. Belongs to the TGF-beta family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Motility/polarity/chemotaxis; Cell development/differentiation; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1q41

Cellular Component: extracellular matrix; extracellular space; cell soma; axon; extracellular region; endosome

Molecular Function: protein binding; protein homodimerization activity; growth factor activity; protein heterodimerization activity; beta-amyloid binding; punt binding; cytokine activity; transforming growth factor beta receptor binding; receptor binding; receptor signaling protein serine/threonine kinase activity

Biological Process: heart morphogenesis; extracellular matrix organization and biogenesis; collagen fibril organization; catagen; heart development; SMAD protein nuclear translocation; dopamine biosynthetic process; protein amino acid phosphorylation; cell-cell signaling; hair follicle development; transforming growth factor beta receptor signaling pathway; somatic stem cell division; cell cycle arrest; cell growth; embryonic gut development; cartilage condensation; response to drug; neutrophil chemotaxis; platelet activation; negative regulation of immune response; neuron fate commitment; positive regulation of cell cycle; positive regulation of catagen; positive regulation of cell growth; positive regulation of phosphoinositide 3-kinase cascade; cardioblast differentiation; positive regulation of protein secretion; positive regulation of cell division; activation of protein kinase activity; neuron development; response to progesterone stimulus; positive regulation of heart contraction; cell death; axon guidance; positive regulation of immune response; wound healing; cell morphogenesis; cardiac muscle cell proliferation; positive regulation of stress-activated MAPK cascade; odontogenesis; negative regulation of cell proliferation; platelet degranulation; positive regulation of neuron apoptosis; salivary gland morphogenesis; positive regulation of cell proliferation; response to wounding; hemopoiesis; angiogenesis; positive regulation of integrin biosynthetic process; negative regulation of epithelial cell proliferation; uterine wall breakdown; intercellular junction assembly and maintenance; regulation of transforming growth factor-beta2 production; cell migration; hair follicle morphogenesis; positive regulation of cell adhesion mediated by integrin; glial cell migration; positive regulation of ossification; cell proliferation; embryonic development; eye development; generation of neurons; positive regulation of cardioblast differentiation; response to hypoxia; epithelial to mesenchymal transition; blood vessel remodeling; negative regulation of cell growth; blood coagulation

Disease: Loeys-dietz Syndrome 4

Research Articles on TGFB2

Similar Products

Product Notes

The TGFB2 tgfb2 (Catalog #AAA7114993) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 303-414aa; Full Length of Mature Protein. The amino acid sequence is listed below: ALDAAYCFRN VQDNCCLRPL YIDFKRDLGW KWIHEPKGYN ANFCAGACPY LWSSDTQHSR VLSLYNTINP EASASPCCVS QDLEPLTILY YIGKTPKIEQ LSNMIVKSCK CS. It is sometimes possible for the material contained within the vial of "Transforming Growth Factor beta-2 (TGFB2), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.