Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Thrombopoietin (THPO) Active Protein | THPO active protein

Recombinant Human Thrombopoietin (THPO)

Gene Names
THPO; ML; TPO; MGDF; MKCSF; MPLLG; THCYT1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thrombopoietin (THPO); Recombinant Human Thrombopoietin (THPO); Thrombopoietin; C-mpl ligand; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; Myeloproliferative leukemia virus oncogene ligand; THPO; THPO active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Sequence Positions
22-353aa; Full Length of Mature Protein
Sequence
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Sequence Length
353
Species
Human
Tag
N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using MO7e human megakaryocytic leukemic cells is less than 10 ng/ml.
Subcellular Location
Secreted
Protein Families
EPO/TPO Family
Classification
Cytokine
Subdivision
Growth Factor
Pathway
Jak-STAT Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for THPO active protein
Relevance: Thrombopoietin (TPO) is a glycoprotein hormone which belongs to the EPO/TPO family. It produced by the liver and kidney which regulates the production of platelets. TPO stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Lineage-specific cytokine affects the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

Function: Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
Product Categories/Family for THPO active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
37.3 kDa
NCBI Official Full Name
Thrombopoietin
NCBI Official Synonym Full Names
thrombopoietin
NCBI Official Symbol
THPO
NCBI Official Synonym Symbols
ML; TPO; MGDF; MKCSF; MPLLG; THCYT1
NCBI Protein Information
thrombopoietin
UniProt Protein Name
Thrombopoietin
Protein Family
UniProt Gene Name
THPO
UniProt Synonym Gene Names
MGDF; ML; MGDF
UniProt Entry Name
TPO_HUMAN

NCBI Description

Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent. [provided by RefSeq, Feb 2014]

Uniprot Description

THPO: Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets. Defects in THPO are the cause of thrombocythemia type 1 (THCYT1). A myeloproliferative disorder characterized by elevated platelet levels due to sustained proliferation of megakaryocytes, and frequently lead to thrombotic and haemorrhagic complications. Belongs to the EPO/TPO family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Secreted; Cytokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3q27

Cellular Component: extracellular space

Molecular Function: growth factor activity; hormone activity; cytokine activity

Biological Process: positive regulation of protein kinase B signaling cascade; cell proliferation; platelet activation; multicellular organismal development; myeloid cell differentiation; positive regulation of megakaryocyte differentiation; positive regulation of protein amino acid phosphorylation; blood coagulation

Disease: Thrombocythemia 1

Research Articles on THPO

Similar Products

Product Notes

The THPO thpo (Catalog #AAA7114994) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-353aa; Full Length of Mature Protein. The amino acid sequence is listed below: SPAPPACDLR VLSKLLRDSH VLHSRLSQCP EVHPLPTPVL LPAVDFSLGE WKTQMEETKA QDILGAVTLL LEGVMAARGQ LGPTCLSSLL GQLSGQVRLL LGALQSLLGT QLPPQGRTTA HKDPNAIFLS FQHLLRGKVR FLMLVGGSTL CVRRAPPTTA VPSRTSLVLT LNELPNRTSG LLETNFTASA RTTGSGLLKW QQGFRAKIPG LLNQTSRSLD QIPGYLNRIH ELLNGTRGLF PGPSRRTLGA PDISSGTSDT GSLPPNLQPG YSPSPTHPPT GQYTLFPLPP TLPTPVVQLH PLLPDPSAPT PTPTSPLLNT SYTHSQNLSQ EG. It is sometimes possible for the material contained within the vial of "Thrombopoietin (THPO), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.