Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MHC Class I Polypeptide-Related Sequence A (MICA) Active Protein | MICA active protein

Recombinant Human MHC Class I Polypeptide-Related Sequence A (MICA), Partial

Gene Names
MICA; MIC-A; PERB11.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
MHC Class I Polypeptide-Related Sequence A (MICA); Recombinant Human MHC Class I Polypeptide-Related Sequence A (MICA); Partial; MHC Class I Polypeptide-Related Sequence A; MIC-A; MICA; PERB11.1; MICA active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Specificity
Widely expressed with the exception of the central nervous system where it is absent. Expressed predominantly in gastric epithelium and also in monocytes, keratinocytes, endothelial cells, fibroblasts and in the outer layer of Hassal's corpuscles within the medulla of normal thymus. In skin, expressed mainly in the keratin layers, basal cells, ducts and follicles. Also expressed in many, but not all, epithelial tumors of lung, breast, kidney, ovary, prostate and colon. In thyomas, overexpressed in cortical and medullar epithelial cells. Tumors expressing MICA display increased levels of gamma delta T-cells.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
Sequence Positions
23-308aa; Partial
Sequence
AEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
Sequence Length
383
Species
Human
Tag
C-terminal FC-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human N2DL2 in functional ELISA is less than 5 ug/ml.
Subcellular Location
Cell Membrane, Single-Pass Type I Membrane Protein, Cytoplasm
Protein Families
MHC Class I Family, MIC Subfamily
Classification
Other Recombinant Protein
Pathway
Natural Killer Cell Mediated Cytotoxicity
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for MICA active protein
Relevance: MHC class I polypeptide-related sequence A, also known as MIC-A, PERB11. 1 and MICA, is a single-pass type I membrane protein which belongs to the MHC class I family of MIC subfamily. MICA contains one Ig-like C1-type domain and is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by NK cells, NKT cells, and most of the subtypes of T cells. MICA is the ligand for NK cell activating receptor KLRK1/NKG2D. MICA seems to have no role in antigen presentation. MICA leads to cell lysis by binding to KLRK1.

Function: Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T-cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis.
Product Categories/Family for MICA active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
59.9 kDa
NCBI Official Full Name
MHC class I polypeptide-related sequence A
NCBI Official Synonym Full Names
MHC class I polypeptide-related sequence A
NCBI Official Symbol
MICA
NCBI Official Synonym Symbols
MIC-A; PERB11.1
NCBI Protein Information
MHC class I polypeptide-related sequence A
UniProt Protein Name
MHC class I polypeptide-related sequence A
Protein Family
UniProt Gene Name
MICA
UniProt Synonym Gene Names
MIC-A
UniProt Entry Name
MICA_HUMAN

NCBI Description

This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. The protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Uniprot Description

MICA: Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T- cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis. Anti-MICA antibodies and ligand shedding are involved in the progression of monoclonal gammopathy of undetermined significance (MGUS)to multiple myeloma. Genetic variations in MICA may be a cause of susceptibility to psoriasis type 1 (PSORS1). Psoriasis is a common, chronic inflammatory disease of the skin with multifactorial etiology. It is characterized by red, scaly plaques usually found on the scalp, elbows and knees. These lesions are caused by abnormal keratinocyte proliferation and infiltration of inflammatory cells into the dermis and epidermis. Genetic variation in MICA is a cause of susceptibility to psoriatic arthritis (PSORAS). PSORAS is an inflammatory, seronegative arthritis associated with psoriasis. It is a heterogeneous disorder ranging from a mild, non-destructive disease to a severe, progressive, erosive arthropathy. Five types of psoriatic arthritis have been defined: asymmetrical oligoarthritis characterized by primary involvement of the small joints of the fingers or toes; asymmetrical arthritis which involves the joints of the extremities; symmetrical polyarthritis characterized by a rheumatoidlike pattern that can involve hands, wrists, ankles, and feet; arthritis mutilans, which is a rare but deforming and destructive condition; arthritis of the sacroiliac joints and spine (psoriatic spondylitis). Belongs to the MHC class I family. MIC subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.33

Cellular Component: extracellular space; cell surface; integral to plasma membrane; cytoplasm

Molecular Function: protein binding; beta-2-microglobulin binding; antigen binding; natural killer cell lectin-like receptor binding

Biological Process: antigen processing and presentation; viral reproduction; natural killer cell mediated cytotoxicity; response to heat; cytolysis; defense response to bacterium; immune response to tumor cell; gamma-delta T cell activation; response to DNA damage stimulus; defense response to virus; T cell mediated cytotoxicity

Disease: Psoriatic Arthritis, Susceptibility To; Psoriasis 1, Susceptibility To

Research Articles on MICA

Similar Products

Product Notes

The MICA mica (Catalog #AAA7115152) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-308aa; Partial. The amino acid sequence is listed below: AEPHSLRYNL TVLSWDGSVQ SGFLTEVHLD GQPFLRCDRQ KCRAKPQGQW AEDVLGNKTW DRETRDLTGN GKDLRMTLAH IKDQKEGLHS LQEIRVCEIH EDNSTRSSQH FYYDGELFLS QNLETKEWTM PQSSRAQTLA MNVRNFLKED AMKTKTHYHA MHADCLQELR RYLKSGVVLR RTVPPMVNVT RSEASEGNIT VTCRASGFYP WNITLSWRQD GVSLSHDTQQ WGDVLPDGNG TYQTWVATRI CQGEEQRFTC YMEHSGNHST HPVPSGKVLV LQSHWQ. It is sometimes possible for the material contained within the vial of "MHC Class I Polypeptide-Related Sequence A (MICA), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.