Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-9 (IL9) Active Protein | IL9 active protein

Recombinant Human Interleukin-9 (IL9)

Gene Names
IL9; P40; HP40; IL-9
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-9 (IL9); Recombinant Human Interleukin-9 (IL9); Interleukin-9; IL-9; Cytokine P40; T-Cell Growth Factor P40; IL9; IL9 active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
Sequence Positions
19-144aa; Full Length of Mature Protein
Sequence
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Sequence Length
144
Species
Human
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using MO7e human megakaryocytic leukemic cells is typically less than 0.5 ng/ml
Subcellular Location
Secreted
Protein Families
IL-7/IL-9 Family
Classification
Cytokine
Subdivision
Interleukin
Pathway
Jak-STAT Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for IL9 active protein
Relevance: Interleukin-9 (IL-9) is a secreted protein that belongs to the IL-7/IL-9 family. IL-9 supports IL-2 independent and IL-4 independent growth of helper T-cells. IL-9 stimulates cell proliferation and prevents apoptosis. It functions through the IL-9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 has been identified as a candidate gene for asthma. IL-9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.

Function: Supports IL-2 independent and IL-4 independent growth of helper T-cells.
Product Categories/Family for IL9 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15.16 kDa
NCBI Official Full Name
interleukin-9
NCBI Official Synonym Full Names
interleukin 9
NCBI Official Symbol
IL9
NCBI Official Synonym Symbols
P40; HP40; IL-9
NCBI Protein Information
interleukin-9
UniProt Protein Name
Interleukin-9
Protein Family
UniProt Gene Name
IL9
UniProt Synonym Gene Names
IL-9
UniProt Entry Name
IL9_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. [provided by RefSeq, Jul 2008]

Uniprot Description

IL9: Supports IL-2 independent and IL-4 independent growth of helper T-cells. Belongs to the IL-7/IL-9 family.

Protein type: Secreted; Secreted, signal peptide; Cytokine

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: extracellular space

Molecular Function: growth factor activity; interleukin-9 receptor binding; cytokine activity

Biological Process: positive regulation of cell proliferation; immune response; inflammatory response; positive regulation of cell growth; positive regulation of interleukin-5 biosynthetic process

Research Articles on IL9

Similar Products

Product Notes

The IL9 il9 (Catalog #AAA7115028) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-144aa; Full Length of Mature Protein. The amino acid sequence is listed below: QGCPTLAGIL DINFLINKMQ EDPASKCHCS ANVTSCLCLG IPSDNCTRPC FSERLSQMTN TTMQTRYPLI FSRVKKSVEV LKNNKCPYFS CEQPCNQTTA GNALTFLKSL LEIFQKEKMR GMRGKI. It is sometimes possible for the material contained within the vial of "Interleukin-9 (IL9), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.