Interleukin-15 Receptor Subunit alpha (Il15ra) Active Protein | Il15ra active protein
Recombinant Mouse Interleukin-15 Receptor Subunit alpha (Il15ra), Partial
Gene Names
Il15ra; IL-15RA; AA690181
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-15 Receptor Subunit alpha (Il15ra); Recombinant Mouse Interleukin-15 Receptor Subunit alpha (Il15ra); Partial; Interleukin-15 receptor subunit alpha; Il15ra; sIL-15 receptor subunit alpha; Il15ra active protein
Host
Mammalian Cell
Specificity
Widely expressed.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
Sequence Positions
33-205aa; Partial
Sequence
GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK
Sequence Length
263
Species
Mouse
Tag
C-terminal FC-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL-2 mouse cytotoxic T cells is less than 10 ng/ml.
Subcellular Location
Membrane, Single-Pass Type I Membrane Protein, Nucleus Membrane, Single-Pass Type I Membrane Protein, SUBCELLULAR LOCATION: Soluble interleukin-15 receptor subunit alpha: Secreted, Extracellular Space
Classification
Cytokine
Subdivision
Interleukin
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Il15ra active protein
Relevance: Mouse interleukin-15 receptor subunit alpha, also known as Il15ra, is a high-affinity receptor for interleukin-15. Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits (Common gamma chain, or gamma c) to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide variety of Tand B cells and non-lymphoid cells. Human Il15ra shares 45% amino acid sequence homology with the mouse form of the receptor. Eight isoforms of IL-15 R alpha mRNA have been identified, resulting from alternative splicing events involving different exons.
Function: High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Signal transduction involves SYK (By similarity).
Function: High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Signal transduction involves SYK (By similarity).
Product Categories/Family for Il15ra active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
45.5 kDa
NCBI Official Full Name
Interleukin-15 receptor subunit alpha
NCBI Official Synonym Full Names
interleukin 15 receptor, alpha chain
NCBI Official Symbol
Il15ra
NCBI Official Synonym Symbols
IL-15RA; AA690181
NCBI Protein Information
interleukin-15 receptor subunit alpha
UniProt Protein Name
Interleukin-15 receptor subunit alpha
Protein Family
UniProt Gene Name
Il15ra
UniProt Synonym Gene Names
IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA
UniProt Entry Name
I15RA_MOUSE
Uniprot Description
IL15RA: High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves STAT3, STAT5, STAT6, JAK2 and SYK. 8 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Receptor, cytokine
Cellular Component: membrane; integral to membrane; plasma membrane; extracellular region; cytoplasmic vesicle; intracellular; nucleus
Biological Process: positive regulation of natural killer cell differentiation; JAK-STAT cascade
Research Articles on Il15ra
Similar Products
Product Notes
The Il15ra il15ra (Catalog #AAA7115077) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 33-205aa; Partial. The amino acid sequence is listed below: GTTCPPPVSI EHADIRVKNY SVNSRERYVC NSGFKRKAGT STLIECVINK NTNVAHWTTP SLKCIRDPSL AHYSPVPTVV TPKVTSQPES PSPSAKEPEA FSPKSDTAMT TETAIMPGSR LTPSQTTSAG TTGTGSHKSS RAPSLAATMT LEPTASTSLR ITEISPHSSK MTK. It is sometimes possible for the material contained within the vial of "Interleukin-15 Receptor Subunit alpha (Il15ra), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
