Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Ephrin-A5 (EFNA5) Active Protein | EFNA5 active protein

Recombinant Human Ephrin-A5 (EFNA5) (Active)

Gene Names
EFNA5; AF1; EFL5; RAGS; EPLG7; GLC1M; LERK7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ephrin-A5 (EFNA5); Recombinant Human Ephrin-A5 (EFNA5) (Active); AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7; EFNA5 active protein
Ordering
For Research Use Only!
Host
Mammalian cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4.
Sequence Positions
21-203aa; Full Length of Mature Protein
Sequence
QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
Sequence Length
228
Species
Human
Tag
C-terminal FC-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized EPHA3 (MBS956024) at 2 ug/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

SDS-Page ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Biological Activity

Biological Activity
Related Product Information for EFNA5 active protein
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion.
Product Categories/Family for EFNA5 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50.1 kDa
NCBI Official Full Name
ephrin-A5
NCBI Official Synonym Full Names
ephrin A5
NCBI Official Symbol
EFNA5
NCBI Official Synonym Symbols
AF1; EFL5; RAGS; EPLG7; GLC1M; LERK7
NCBI Protein Information
ephrin-A5
UniProt Protein Name
Ephrin-A5
Protein Family
UniProt Gene Name
EFNA5
UniProt Synonym Gene Names
EPLG7; LERK7; LERK-7
UniProt Entry Name
EFNA5_HUMAN

NCBI Description

Ephrin-A5, a member of the ephrin gene family, prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin ligands and receptors have been named by the Eph Nomenclature Committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. [provided by RefSeq, Jul 2008]

Uniprot Description

EFNA5: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion. Belongs to the ephrin family.

Protein type: Cell development/differentiation; Ligand, receptor tyrosine kinase; Motility/polarity/chemotaxis; Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 5q21

Cellular Component: anchored to external side of plasma membrane; extracellular region; plasma membrane; caveola

Molecular Function: ephrin receptor binding; chemorepellent activity

Biological Process: nervous system development; axon guidance; positive regulation of peptidyl-tyrosine phosphorylation; regulation of cell-cell adhesion; apoptosis; regulation of actin cytoskeleton organization and biogenesis; regulation of focal adhesion formation; ephrin receptor signaling pathway; negative chemotaxis; retinal ganglion cell axon guidance

Research Articles on EFNA5

Similar Products

Product Notes

The EFNA5 efna5 (Catalog #AAA7135705) is an Active Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-203aa; Full Length of Mature Protein. The amino acid sequence is listed below: QDPGSKAVAD RYAVYWNSSN PRFQRGDYHI DVCINDYLDV FCPHYEDSVP EDKTERYVLY MVNFDGYSAC DHTSKGFKRW ECNRPHSPNG PLKFSEKFQL FTPFSLGFEF RPGREYFYIS SAIPDNGRRS CLKLKVFVRP TNSCMKTIGV HDRVFDVNDK VENSLEPADD TVHESAEPSR GEN. It is sometimes possible for the material contained within the vial of "Ephrin-A5 (EFNA5), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.