Cytotoxic and Regulatory T-Cell Molecule (CRTAM) Active Protein | CRTAM active protein

Recombinant Human Cytotoxic and Regulatory T-Cell Molecule (CRTAM), Partial

Cat. Num. AAA7115141

• Gene Names: CRTAM; CD355
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cytotoxic and Regulatory T-Cell Molecule (CRTAM); Recombinant Human Cytotoxic and Regulatory T-Cell Molecule (CRTAM); Partial; Cytotoxic and Regulatory T-Cell Molecule; Class-I MHC-Restricted T-Cell-Associated Molecule; CD355; CRTAM; CRTAM active protein

• Host: Mammalian Cell
• Specificity: In the immune system, expression is restricted to activated class-I MHC-restricted cells, including NKT and CD8 cells. Strongly expressed in spleen, thymus, small intestine, peripheral blood leukocyte, and in Purkinje neurons in cerebellum. Expressed at much lower levels in testis, ovary, colon, lung and lymphoid tissues.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Sequence Positions: 18-286aa; Partial
• Sequence: SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKS
• Sequence Length: 194

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human CADM1 in functional ELISA is less than 20 ug/ml.
• Subcellular Location: Membrane, Single-Pass Type I Membrane Protein
• Protein Families: Nectin Family
• Classification: Other Recombinant Protein
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for CRTAM active protein

Relevance: Cytotoxic and Regulatory T-Cell Molecule (CRTAM) is a member of Nectin family under the immunoglobulin superfamily that is expressed by activated CD8+ and NK T cells. CRTAM is found in spleen, thymus, small intestine, peripheral blood, and it is highly expressed by Purkinje cells of the cerebellum. CRTAM is a type I transmembrane glycoprotein containing one Ig-like C2-type domain and one Ig-like V-type domain in its extracellular domain, while its cytoplasmic region shows a potential class I PDZ domain. CRTAM is expressed as a homodimer on the cell surface but does not show homotypic binding in trans. The high affinity of CRTAM/IGSF4 adhesion allows CRTAM to disrupt IGSF4 homotypic interactions. IGSF4 and T cell receptor coengagement of CD8+ cells expressiong CRTAM induces increased IFNgamma or IL-22 production.

Function: Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and interferon-gamma (IFN-gamma) secretion by CD8+ cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM3 in vivo.

Product Categories/Family for CRTAM active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 755571554
• NCBI GeneID: 56253
• NCBI Accession #: NP_001291711.1
• NCBI GenBank Nucleotide #: NM_001304782.1
• UniProt Accession #: O95727
• Molecular Weight: 30.99 kDa
• NCBI Official Full Name: cytotoxic and regulatory T-cell molecule isoform 2
• NCBI Official Synonym Full Names: cytotoxic and regulatory T cell molecule
• NCBI Official Symbol: CRTAM
• NCBI Official Synonym Symbols: CD355
• NCBI Protein Information: cytotoxic and regulatory T-cell molecule
• UniProt Protein Name: Cytotoxic and regulatory T-cell molecule
• Protein Family: Cytotoxic and regulatory T-cell molecule
• UniProt Gene Name: CRTAM
• UniProt Entry Name: CRTAM_HUMAN

NCBI Description

The CRTAM gene is upregulated in CD4 (see MIM 186940)-positive and CD8 (see CD8A; MIM 186910)-positive T cells and encodes a type I transmembrane protein with V and C1-like Ig domains (Yeh et al., 2008 [PubMed 18329370]).[supplied by OMIM, Feb 2009]

Uniprot Description

CRTAM: Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and interferon-gamma (IFN-gamma) secretion by CD8+ cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM3 in vivo. Belongs to the nectin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q24.1

Cellular Component: cell-cell adherens junction; integral to plasma membrane; plasma membrane

Molecular Function: cell adhesion molecule binding; protein homodimerization activity; receptor activity; receptor binding

Biological Process: activated T cell proliferation; cell recognition; detection of stimulus; detection of tumor cell; heterophilic cell adhesion; homophilic cell adhesion; positive regulation of cytokine secretion; positive regulation of natural killer cell mediated cytotoxicity; positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target; regulation of immune response; T cell mediated cytotoxicity