CD355 recombinant protein
CD355 Recombinant Protein
Gene Names
CRTAM; CD355
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD355; CD355 Recombinant Protein; CD355 recombinant protein
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
822
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.
Testing Data
()
Related Product Information for CD355 recombinant protein
Background: CD355, mediates heterophilic cell-cell adhesion which regulates the activation, differentiation and tissue retention of various T-cell subsets. Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and IFNG/interferon-gamma secretion by CD8+ T-cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM1 in vivo. Regulates CD8+ T-cell proliferation in response to T-cell receptor (TCR) activation. Appears to be dispensable for CD8+ T-cell-mediated cytotoxicity. Interaction with SCRIB promotes the late phase of cellular polarization of a subset of CD4+ T-cells, which in turn regulates TCR-mediated proliferation and IFNG, IL17 and IL22 production.By interacting with CADM1 on CD8+ dendritic cells, regulates the retention of activated CD8+ T-cells within the draining lymph node (By similarity).Required for the intestinal retention of intraepithelial CD4+ CD8+ T-cells and, to a lesser extent, intraepithelial and lamina propria CD8+ T-cells and CD4+ T-cells (By similarity).Interaction with CADM1 promotes the adhesion to gut-associated CD103+ dendritic cells, which may facilitate the expression of gut-homing and adhesion molecules on T-cells and the conversion of CD4+ T-cells into CD4+ CD8+ T-cells (By similarity).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,256 Da
NCBI Official Full Name
cytotoxic and regulatory T-cell molecule Isoform 2
NCBI Official Synonym Full Names
cytotoxic and regulatory T-cell molecule
NCBI Official Symbol
CRTAM
NCBI Official Synonym Symbols
CD355
NCBI Protein Information
cytotoxic and regulatory T-cell molecule
UniProt Protein Name
Cytotoxic and regulatory T-cell molecule
UniProt Gene Name
CRTAM
UniProt Entry Name
CRTAM_HUMAN
Uniprot Description
CRTAM: Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and interferon-gamma (IFN-gamma) secretion by CD8+ cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM3 in vivo. Belongs to the nectin family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Apoptosis; Membrane protein, integral
Chromosomal Location of Human Ortholog: 11q24.1
Cellular Component: cell-cell adherens junction; integral to plasma membrane; plasma membrane
Molecular Function: cell adhesion molecule binding; protein homodimerization activity; receptor activity; receptor binding
Biological Process: activated T cell proliferation; cell recognition; detection of stimulus; detection of tumor cell; heterophilic cell adhesion; homophilic cell adhesion; positive regulation of cytokine secretion; positive regulation of natural killer cell mediated cytotoxicity; positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target; regulation of immune response; T cell mediated cytotoxicity
