Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CD160 Antigen (CD160) Active Protein | CD160 active protein

Recombinant Human CD160 Antigen (CD160)

Gene Names
CD160; NK1; BY55; NK28
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD160 Antigen (CD160); Recombinant Human CD160 Antigen (CD160); CD160 Antigen; Natural Killer Cell Receptor BY55; CD160; BY55; CD160 active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Specificity
Expressed in spleen, peripheral blood, and small intestine. Expression is restricted to functional NK and T cytotoxic lymphocytes.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
Sequence Positions
27-159aa; Full Length of Mature Protein
Sequence
INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS
Sequence Length
181
Species
Human
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Mouse TNFRSF14 in functional ELISA is less than 50 ug/ml.
Subcellular Location
Cell Membrane, Lipid-Anchor, GPI-Anchor
Classification
Drug Target
Subdivision
Immune Checkpoint
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CD160 active protein
Relevance: CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in the spleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for both classical and non-classical MHC class I molecules.

Function: Receptor showing broad specificity for both classical and non-classical MHC class I molecules.
Product Categories/Family for CD160 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15.8 kDa
NCBI Official Full Name
CD160 antigen
NCBI Official Synonym Full Names
CD160 molecule
NCBI Official Symbol
CD160
NCBI Official Synonym Symbols
NK1; BY55; NK28
NCBI Protein Information
CD160 antigen
UniProt Protein Name
CD160 antigen
Protein Family
UniProt Gene Name
CD160
UniProt Synonym Gene Names
BY55
UniProt Entry Name
BY55_HUMAN

NCBI Description

CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predicts a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain weakly homologous to KIR2DL4 molecule. CD160 is expressed at the cell surface as a tightly disulfide-linked multimer. RNA blot analysis revealed CD160 mRNAs of 1.5 and 1.6 kb whose expression was highly restricted to circulating NK and T cells, spleen and small intestine. Within NK cells CD160 is expressed by CD56dimCD16+ cells whereas among circulating T cells its expression is mainly restricted to TCRgd bearing cells and to TCRab+CD8brightCD95+CD56+CD28-CD27-cells. In tissues, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 shows a broad specificity for binding to both classical and nonclassical MHC class I molecules. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Receptor showing broad specificity for both classical and non-classical MHC class I molecules. Ref.3

Subunit structure: Homomultimer; disulfide-linked.

Subcellular location: Cell membrane; Lipid-anchor › GPI-anchor.

Tissue specificity: Expressed in spleen, peripheral blood, and small intestine. Expression is restricted to functional NK and T cytotoxic lymphocytes.

Sequence similarities: Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Research Articles on CD160

Similar Products

Product Notes

The CD160 cd160 (Catalog #AAA7115119) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-159aa; Full Length of Mature Protein. The amino acid sequence is listed below: INITSSASQE GTRLNLICTV WHKKEEAEGF VVFLCKDRSG DCSPETSLKQ LRLKRDPGID GVGEISSQLM FTISQVTPLH SGTYQCCARS QKSGIRLQGH FFSILFTETG NYTVTGLKQR QHLEFSHNEG TLS. It is sometimes possible for the material contained within the vial of "CD160 Antigen (CD160), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.